KEGG   Lodderomyces elongisporus: LELG_02358Help
Entry
LELG_02358        CDS       T01116                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
lel  Lodderomyces elongisporus
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    LELG_02358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 110 aa AA seqDB search
MPAPYEKGSSKKGATLFKTRCLQCHTTEKGGANKVGPNLHGVFGRHSGQAEGYSYTEANK
KAGVLWDEQHMSDYLENPKKYIPGTKMAFAGLKKAKDRNDLVTYLKEATS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccatacgaaaaaggatcatcaaagaaaggtgctacacttttcaagaccaga
tgtttgcaatgtcacacaaccgaaaaaggtggtgctaacaaggttggtccaaacttgcac
ggtgtctttggtagacactcaggtcaagctgaaggttacagttacacagaggccaacaag
aaggccggtgtcctttgggatgaacaacacatgtctgactaccttgaaaacccaaagaag
tacattccaggtacaaagatggcctttgctggtcttaagaaggctaaggaccgtaacgat
cttgttacctacttgaaggaagctacttcttaa

DBGET integrated database retrieval system