KEGG   Lodderomyces elongisporus: LELG_02362Help
Entry
LELG_02362        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LELG_02362
Peptidases [BR:lel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LELG_02362
Transcription machinery [BR:lel03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     LELG_02362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 690 aa AA seqDB search
MLQGQKKKKQIKLNIRVAQVSLLQTRYPRVFTSCHFHITTIQLVTSVIFTICFLSIVFKS
VFFFLSLHSIHYSFISIHSSPVKSSLYLIKLYTAFLVMSSSLTTTSQTATIESTLLKHGT
LNGVVSNTKTNGSPHDSHSNGNSSSSSNNNNNNNNNHYDHPLHILHSPLVLDNYGSLSSC
AHLDKVLQSRAKDTVFETYRQAVLISQPIKDTYTYKARNGGGDVIDRAALQRKQLLALKC
TDCGNSQFQEVLICLQCPQVSCSQHSHGHYKELLHMFAIDSKLGLLYCLKCDGYVNSKRL
NDIRCEVMGVHSLQSIEEKADDKNDVDLKQEIGKGSEENGVKENRSNQNFINPNMLATMG
LKGFVNLGSTCFMSSILQTFIHNPIIRTQFFNNDNHYFNCKLLHDQEVQGSLHEGNACIT
CSIDKIFKDFFTMQNTEGYGMTYLLATAWYKQKSLAGFQEQDAHEFWQFLLNEFHLDHAR
ISSVEKVCSCISHICFGFELQSCVRCECGAENITVDPPTFEMSLELTLEKENSNSITVGG
CLDSFTREEILDTKISCKSCLKESGASRTLRLKTTPPVLSIQLKRFNHSISNDKSSKVEA
AVDVPLFLDMNKYTINEQADNNSKPILYELFSVVCHLGLVNTGHYIVYTKNSQGRWFKFD
DSVITIEDETSAISAIRSTGYLLYYILHNV
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgttacagggacaaaaaaaaaaaaaacagatcaaactaaacattagagttgcacaagtg
agtcttttacaaaccaggtaccctcgagtttttacatcttgtcattttcacattacaact
atacaactggttacaagcgttatttttactatttgctttttatctattgtttttaaatct
gtttttttttttctgtctttgcattctattcattactcattcatatccatccattcttct
ccggttaaatcctcactatatttgatcaaactttacactgcatttttagtcatgtcctca
tcactgaccaccacatcccaaactgcaactattgagagcacactgctaaaacatggcaca
cttaatggagttgtttccaatacaaagactaacggttctccacacgacagtcatagcaat
ggcaacagcagtagtagtagcaacaacaacaacaacaacaacaacaaccattatgatcat
cccctacatattttgcattcgcctcttgtgctcgataattatggatctttaagttcgtgt
gcgcatctagacaaagtcttgcaatcgcgtgccaaagataccgtttttgaaacttatcga
caagcagtactcatatcccagccaataaaggatacttatacgtataaagcaagaaatggt
ggtggagatgtgattgatcgcgcggcgctacaaagaaagcaactcctggccttgaaatgc
accgactgcggcaactctcagtttcaggaagtgttgatctgtctacaatgccctcaagtg
agctgtagtcaacattcgcatggtcattataaggagctgctgcacatgtttgctattgac
tcaaaactcggtttactttattgtctcaaatgcgatgggtatgtcaacagcaaaagatta
aatgatatccgatgcgaggtaatgggagtgcattcactacaaagtatagaggaaaaggca
gatgacaaaaatgatgttgatctaaaacaagagattggaaaaggctcagaagaaaatgga
gtgaaagagaacagaagcaaccaaaattttatcaaccctaatatgttggccaccatgggt
ctcaaggggttcgttaatttgggatcaacgtgttttatgagttctattcttcaaacattt
atccataacccaataatcagaacccagttcttcaataacgacaaccactatttcaactgt
aagcttctacatgatcaagaagttcaaggttcacttcatgaaggaaacgcgtgtattaca
tgcagcatagataagatctttaaagatttcttcactatgcagaatactgaaggatacggg
atgacatacctccttgcgacagcctggtataagcaaaagtcacttgctggttttcaagaa
caagatgcacacgagttttggcagtttcttttgaatgagtttcacctggatcacgccaga
atctcttctgtagaaaaagtttgctcgtgtatcagtcatatttgctttggatttgaattg
cagagttgtgtcaggtgtgaatgtggtgcagagaatattactgttgatccacctacattt
gaaatgtctctagagcttactctggaaaaggaaaactccaactcgatcacagtgggcgga
tgtcttgactcattcaccagggaggagatcttggatactaaaatttcgtgcaaatcgtgt
cttaaagaatctggagcatcaagaacacttcgcttaaagacaaccccgccagttctttct
atccaactcaagcggttcaatcatagtatttccaacgataaatcatccaaagttgaagct
gcagtagatgtgccattattcttggacatgaacaaatacacaatcaatgagcaagcagat
aacaatagtaaaccaattctatatgagcttttttctgttgtttgccatttgggactggtc
aacactgggcattatattgtatacacaaagaacagtcaaggccggtggtttaagtttgat
gatagcgttatcaccatagaagatgagacttctgcaatttcagctatcagatcaaccggc
tatcttttgtattacattttgcataacgtctaa

DBGET integrated database retrieval system