KEGG   Lodderomyces elongisporus: LELG_02388Help
Entry
LELG_02388        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
lel  Lodderomyces elongisporus
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    LELG_02388
Enzymes [BR:lel01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     LELG_02388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 822 aa AA seqDB search
MTEVLPRNGHQRQLFLDAEDKTAEALTKYQNLQQCTYMNKGIGCPSNSKRGREYMTCDCE
EDWDSSTEQNMACGEDSNCINRITSVECINRHCSCGENCQNQRFQKKQYADVSVFQTELK
GYGLRANTQLREGDFIYEYIGEVIDEPTFRQKMIEYDLKQYKHFYFMMLKNDAFIDATEK
GSLARFVNHSCSPNAFVDKWVVADRLRMGIFAKRDIMAGEEITFDYNVDRYGAQSQPCYC
GEPNCLKFMGGKTQTDAALLLPEGVSEALGVNSRIEKAWLKENKHLRSEQQADDATINEM
FVKSLQVEPMEDLDVSKVIGALMKAQQQSLIKKLVERMHLTTDEYVNKLLVKFHGYKTLS
SVLQEVATSAGDADENAKDDGDDELVIWILEVLARWPAITKNKISSSQIEDVVKEVKERS
KNEEIVVLCEKLLQQWSQLEMAYRIPKIKNPVVTSSGFDRKSKSPTKETLDESTAEKSNG
RPPAPSYRLPANWETTFDESSGKWYFYNKITRETDWNPPKGSVPVGPARVGSMLGTSRGA
RSHEGYPKGPSSYASHPYDSNHGHNHATGRNHNNSHNHNYNSSFQETRGPLFKHKELEIT
RREEERIQKEREAKAQELAAKERQVMEMIEQAKMVSQTVTPEPEKKSRHKDKRGQSSSRS
DYKPKEHKSKEHKSKENSIESQWKRVLAKHIPNLIKKHQAEIGKDNVKGCAKEIVNNLAR
REAQKENAKLPPEELEKHKIKKIKAFTDSFMDKFLIKYRRKHQSRKRKLDQDGNGEIEGV
DDIMGDANELESPVANVTGDGSGEVDTSKEEAEDNDVKRVKV
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggttttgcctagaaatggacatcagcgacaactcttccttgatgcagaggac
aaaaccgctgaagcactcaccaaataccaaaaccttcaacaatgtacttatatgaataaa
ggcattggatgtccgagcaattcgaaacgagggcgagagtatatgacctgtgactgtgaa
gaagattgggatagctctacagagcagaacatggcatgtggcgaggactcaaactgtatc
aatcgaatcacatctgtggaatgtatcaaccgacattgttcatgtggcgagaattgtcaa
aaccaacggtttcaaaaaaagcaatatgccgatgtatctgttttccaaaccgaactaaag
gggtatggtctcagagcaaacacgcagttgcgtgagggggatttcatatatgaatatatt
ggggaagtgattgatgaaccaacatttagacaaaaaatgattgagtacgatctcaagcag
tataagcatttttattttatgatgttgaaaaatgatgcatttattgacgctactgagaag
ggtagccttgcaagatttgtgaatcattcatgtagtcccaacgcatttgttgacaagtgg
gttgttgccgatagattgagaatgggaatttttgccaagagagacattatggctggcgag
gaaatcacatttgactataatgtcgaccgatatggtgctcagtctcagccatgttattgt
ggtgaaccaaactgtttgaaatttatgggtggaaagacacagactgatgccgcattattg
ttgcccgaaggtgtgagcgaagctttgggggttaattctagaattgaaaaagcttggttg
aaagaaaacaaacatttaaggtcagaacaacaggctgatgatgccacaatcaatgagatg
tttgtcaagagtctacaagtggaaccaatggaggacttggatgtttcaaaagtaattggt
gcgttgatgaaggctcaacagcaatcattgatcaagaaattagttgagaggatgcatctc
actacagatgagtatgtcaataagttgcttgttaaattccatggatacaagactttatcc
agtgtcttgcaagaggtcgccactagtgctggtgatgcagatgaaaatgctaaagatgat
ggtgatgacgaattagtcatttggatattggaagtgcttgccaggtggcctgcaattaca
aaaaacaagatttcatcatcacaaatcgaggatgtagttaaagaggtgaaggaaaggagt
aagaatgaggaaatagttgtgctttgcgaaaagttgctccagcaatggtcgcagcttgaa
atggcgtatcgtataccaaaaatcaaaaaccctgttgttaccagttctggttttgataga
aaatcaaagtcacctactaaggagacacttgacgaaagtacagctgagaagtcaaatgga
cgacccccagcaccaagttatagattaccggcaaattgggagaccacatttgatgaatca
tcggggaaatggtatttttacaacaagattactagagaaactgactggaaccctcctaaa
ggttcagtgcccgtgggaccagcaagagtaggatcgatgctgggtacatctcgaggtgca
cgctctcatgagggatatcccaaaggtccaagctcttatgcaagccatccctatgatagc
aatcatggtcacaaccacgctactggccgtaaccacaacaatagccacaatcataactac
aactcctcatttcaagagactagagggccactgtttaagcataaagaattggaaatcaca
cgacgagaagaagaacggatacagaaggagagagaggcaaaagcgcaggaacttgcagca
aaagagagacaagtgatggaaatgattgaacaagccaaaatggtctctcaaacagttact
cctgagccggaaaagaagtcgcgtcacaaggataagcgtggccaatcgagtagtagatct
gattacaaaccaaaagaacacaaatctaaagagcacaaatctaaagagaactctattgaa
tcacaatggaaacgtgtattggcaaaacatataccaaacttgatcaaaaagcaccaagct
gaaataggtaaagataatgttaaaggatgtgctaaagaaattgtgaacaacttggcaaga
cgcgaagctcaaaaagaaaatgccaagctgccaccggaggaattggaaaaacacaaaata
aagaagatcaaggcgtttaccgactcatttatggacaaatttttaatcaagtacaggagg
aagcatcagagtagaaagaggaagttggatcaagatggaaatggcgaaattgaaggtgtt
gatgatataatgggtgatgctaatgaactagaaagtccagtggcaaatgtcacgggcgat
ggcagtggcgaagtcgatacgagtaaagaagaggcagaagataatgatgttaaaagggtg
aaagtatag

DBGET integrated database retrieval system