KEGG   Lodderomyces elongisporus: LELG_02443Help
Entry
LELG_02443        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
lel  Lodderomyces elongisporus
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:lel03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:lel03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:lel03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lel03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 262 aa AA seqDB search
MSEYGNFGNYGGNYGDGGFTNTGYSQGGFSNENGSQSGGTKTQGRSSLTPVTIKQILEAT
QATPDGDFLVHNVTLSMISFVGVVRKVDGQGMSVIITVEDGTGSIDVRKWVDESTTSLAV
ETEKYSAFKNKYVFVGGSLKLHMNKKSIQNAAIALIEDSNQIIYHHLSAIDHHLKSQGLP
KSSGANTDGDLFVKDEDSNESLMNRVLKFITEESKTMQDGVPINYIAEKLGISKDEGLRQ
CNELIENGRIYLGFNDGGYIAV
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaatacggtaattttggaaattatggaggcaactatggtgatggaggattcacc
aatactggctattctcaaggtggatttagcaatgaaaatggttcacaatcaggtggtacg
aaaacacaaggtcgttcgagtctaacaccagttacaatcaaacagattttagaagcaaca
caagcaacaccagacggcgacttcctggtacacaacgttactctcagcatgattagtttt
gttggagtcgtgcgtaaagttgatggtcaaggaatgagtgtgatcatcaccgttgaggac
ggtacgggatccatcgatgttcgtaaatgggtagatgaaagtaccacttcattggctgtt
gaaactgaaaaatactcagcttttaagaacaagtacgtttttgttggcggatctttgaaa
ttgcacatgaacaaaaagagtattcagaatgctgccatagcattaatcgaagatagcaat
caaattatttatcatcatttaagcgccattgatcatcacttgaagagccaaggacttccc
aaaagcagtggtgcaaacacagatggtgatttatttgtcaaggacgaagattccaatgaa
tctttgatgaacagagttttgaaatttatcacagaggagagtaagactatgcaagatggt
gttccaataaactacattgccgagaagctaggaatttccaaagacgaaggtttgagacag
tgtaatgagttaattgagaatggaagaatctacctagggtttaatgatggaggctacatt
gctgtttaa

DBGET integrated database retrieval system