KEGG   Lodderomyces elongisporus: LELG_02456Help
Entry
LELG_02456        CDS       T01116                                 

Definition
cAMP-dependent protein kinase type 2
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
lel  Lodderomyces elongisporus
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:lel04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 463 aa AA seqDB search
MTNLLKKLHIHKFDNNQHLEKQQSTPILEQKYSDNNNDNDNNYNMSQQQFSQSSHVPGQA
IAHPGTPQSASNPQNVTATTTANVTQAQANLHAQQQAQLQEQQRQQQFAQQQQQQQQQQQ
QQQQTTAADAAIQKSLLPTRSTVSKGKYSLQDFSIMRTLGTGSFGRVHLVRSVHNGRYYA
IKVLKKQQVVKMKQVEHTNDERKMLKLIEHPFLIRMWGTFQDSNNLFMVMDYIEGGELFS
LLRKSQRFPNPVAKFYAAEVVLALDYLHSHDIIYRDLKPENILLDRNGHIKITDFGFAKE
VTTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIFEMLAGYTPFYDTTPMKTYEKI
LAGKIHYPSFFNPNEIDLLSKLITADLTRRLGNLMNGPADIRNHPWFQEVVWEKLLAKDI
ETPYEPPITAGVGDSSLFDHYPEAQLDYGAQGEDPYAQYFQDF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacttgttgaaaaaactccacatacacaaatttgataacaatcagcacctggaa
aagcaacaatcaacaccaattttagagcagaaatattctgataacaacaacgacaacgac
aacaattacaatatgagtcaacaacagttctcacagtcttcacacgtccccggacaggca
attgcccatccaggaactccacaatcagcatccaacccacaaaatgtcacagctacaaca
acggccaatgttacacaagctcaggccaatttgcatgctcaacaacaagctcaattgcaa
gaacaacaacggcaacaacaatttgctcagcaacaacaacaacaacaacaacaacagcaa
caacagcaacaaactacagcagctgatgccgcaattcagaagtcactacttccaacaagg
tcaactgtcagtaaaggcaagtactcacttcaagacttttccattatgaggactttgggt
actggatcttttgggcgagtccatttggtgaggtctgtgcacaatggaagatactatgcc
atcaaagtattgaagaaacaacaagttgttaaaatgaaacaagttgagcataccaacgac
gaaaggaagatgttaaaattgatcgagcatccttttttgattaggatgtggggtacgttt
caagactcaaataacctatttatggtgatggactatatcgagggtggtgagttgttctct
ttgcttagaaaatcacaaagattccccaaccctgtggccaaattctatgctgctgaagta
gtgttggcattggactatttacacagtcacgacattatctacagagacttgaagccagaa
aatattttgctcgacagaaacggacatatcaagattacagatttcggatttgccaaagag
gttactacagtgacatggactttgtgtggaacacctgattatattgcacccgaagtcatc
accacaaaaccatacaacaaatccgttgattggtggagtcttggagtgttgatctttgag
atgcttgctggatacacaccattttatgataccacgccgatgaagacatacgagaagatt
cttgccggtaaaatccactacccaagcttctttaatccgaatgagattgacttgttgtcg
aagttgattacggcagacttgacaagacgtttgggtaatttgatgaatggaccagcagat
attagaaaccatccatggttccaagaagtcgtgtgggagaagttgttggccaaggatatt
gagactccttatgagccaccaattaccgcaggtgttggtgactcgagtttattcgaccat
tacccggaggcgcaactagactacggtgcacaaggtgaagacccatatgcgcaatatttc
caggacttttaa

DBGET integrated database retrieval system