KEGG   Lodderomyces elongisporus: LELG_02456Help
Entry
LELG_02456        CDS       T01116                                 

Definition
cAMP-dependent protein kinase type 2
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
lel  Lodderomyces elongisporus
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:lel00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    LELG_02456
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     LELG_02456
Protein kinases [BR:lel01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   LELG_02456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 463 aa AA seqDB search
MTNLLKKLHIHKFDNNQHLEKQQSTPILEQKYSDNNNDNDNNYNMSQQQFSQSSHVPGQA
IAHPGTPQSASNPQNVTATTTANVTQAQANLHAQQQAQLQEQQRQQQFAQQQQQQQQQQQ
QQQQTTAADAAIQKSLLPTRSTVSKGKYSLQDFSIMRTLGTGSFGRVHLVRSVHNGRYYA
IKVLKKQQVVKMKQVEHTNDERKMLKLIEHPFLIRMWGTFQDSNNLFMVMDYIEGGELFS
LLRKSQRFPNPVAKFYAAEVVLALDYLHSHDIIYRDLKPENILLDRNGHIKITDFGFAKE
VTTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIFEMLAGYTPFYDTTPMKTYEKI
LAGKIHYPSFFNPNEIDLLSKLITADLTRRLGNLMNGPADIRNHPWFQEVVWEKLLAKDI
ETPYEPPITAGVGDSSLFDHYPEAQLDYGAQGEDPYAQYFQDF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacttgttgaaaaaactccacatacacaaatttgataacaatcagcacctggaa
aagcaacaatcaacaccaattttagagcagaaatattctgataacaacaacgacaacgac
aacaattacaatatgagtcaacaacagttctcacagtcttcacacgtccccggacaggca
attgcccatccaggaactccacaatcagcatccaacccacaaaatgtcacagctacaaca
acggccaatgttacacaagctcaggccaatttgcatgctcaacaacaagctcaattgcaa
gaacaacaacggcaacaacaatttgctcagcaacaacaacaacaacaacaacaacagcaa
caacagcaacaaactacagcagctgatgccgcaattcagaagtcactacttccaacaagg
tcaactgtcagtaaaggcaagtactcacttcaagacttttccattatgaggactttgggt
actggatcttttgggcgagtccatttggtgaggtctgtgcacaatggaagatactatgcc
atcaaagtattgaagaaacaacaagttgttaaaatgaaacaagttgagcataccaacgac
gaaaggaagatgttaaaattgatcgagcatccttttttgattaggatgtggggtacgttt
caagactcaaataacctatttatggtgatggactatatcgagggtggtgagttgttctct
ttgcttagaaaatcacaaagattccccaaccctgtggccaaattctatgctgctgaagta
gtgttggcattggactatttacacagtcacgacattatctacagagacttgaagccagaa
aatattttgctcgacagaaacggacatatcaagattacagatttcggatttgccaaagag
gttactacagtgacatggactttgtgtggaacacctgattatattgcacccgaagtcatc
accacaaaaccatacaacaaatccgttgattggtggagtcttggagtgttgatctttgag
atgcttgctggatacacaccattttatgataccacgccgatgaagacatacgagaagatt
cttgccggtaaaatccactacccaagcttctttaatccgaatgagattgacttgttgtcg
aagttgattacggcagacttgacaagacgtttgggtaatttgatgaatggaccagcagat
attagaaaccatccatggttccaagaagtcgtgtgggagaagttgttggccaaggatatt
gagactccttatgagccaccaattaccgcaggtgttggtgactcgagtttattcgaccat
tacccggaggcgcaactagactacggtgcacaaggtgaagacccatatgcgcaatatttc
caggacttttaa

DBGET integrated database retrieval system