KEGG   Lodderomyces elongisporus: LELG_02468Help
Entry
LELG_02468        CDS       T01116                                 

Definition
(RefSeq) similar to GM10438p
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
lel  Lodderomyces elongisporus
Pathway
Regulation of mitophagy - yeast
Longevity regulating pathway - multiple species
Insulin resistance
Brite
KEGG Orthology (KO) [BR:lel00001]
 Cellular Processes
  Transport and catabolism
   04139 Regulation of mitophagy - yeast
    LELG_02468
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    LELG_02468
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    LELG_02468
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LELG_02468
Protein kinases [BR:lel01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   LELG_02468
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 477 aa AA seqDB search
MLQRGPETMREQAFANAFGRDLADAFEWVMNFKRTNDVTNLNPAWDIYYNVFRRITRQLP
QLVSLELQFVSPMLEKAHNLELALPGTYEAGKPIIRIVKFDPTFSVISSKQRPRKLSIRG
SNGKDYQYVLKGHEDIRQDNLVMQLFGLVNTLLVNDPECFKRHLDIQRYSAIPLSPKVGL
LGWVPNSDTFHMLIKGYRESRSIMLNIEHRLLLQMAPDYDILTLLQKVEVFTSALDNTRG
QDLYKVLWLKSKSSEAWLDRRTTYTRSLAVMSMVGYILGLGDRHPSNLMLNRTTGKVIHI
DFGDCFEAAILREKYPEKVPFRLTRMLNYAMEVSGIEGSFRITCEHVMRVLRDNKESLMA
ILEAFAYDPLINWGFDFPTKVLAEATGIRVNLVNVKDLLRAGKIDEVEAARLQKQNQLEI
RNARAALVLKRITDKLTGNDIKRLKGLDVPTQVDKLIQQATSVENLCQHYIGWCSFW
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaacgtgggccagaaactatgcgagagcaagcatttgcaaatgcgtttggccgt
gatttggcagatgcgtttgaatgggtgatgaactttaaaagaaccaatgatgtaacaaac
ttgaatcccgcctgggatatatattacaatgtctttagaaggatcacaaggcaattacca
cagcttgtgagtcttgagttacaatttgtatcgccaatgcttgaaaaggctcataatttg
gaattggcgttgccgggtacttatgaagcaggaaagccaattatacgaattgtcaagttt
gacccaacattttctgtgatttcatcaaagcaaagacctaggaagctatctattcgagga
agcaatggtaaagattatcaatatgtgttgaaaggtcacgaggatattaggcaggataat
ttggtcatgcaattgtttgggttggtaaacactcttttggtcaatgatccagagtgtttc
aagagacatttggacatccagcgatattcggcaatacctttgtctcccaaagtaggttta
cttggttgggttcctaatagtgatactttccatatgctcattaagggttatagagaatca
agaagtattatgttgaatattgagcatcgtcttttactacaaatggctccagactatgat
attctcacgctattacaaaaagttgaggtatttacaagtgcattagataatacaagagga
caagatttgtacaaggtgctttggctcaagtcgaagtcttctgaagcatggttggatcgc
cgtacaacatacacaagatcattagctgtgatgtctatggttggttatatattgggattg
ggcgataggcacccatccaatttgatgttgaatagaactacaggtaaagttatacacatt
gattttggtgattgctttgaagcagcaatccttcgagaaaagtaccctgaaaaggttcca
ttcaggttaactaggatgttgaattatgcaatggaggtaagtggtattgagggttcattc
cgaattacatgcgaacatgtcatgcgggtgttgcgggacaataaagaatctttgatggcg
attttggaagcatttgcatatgacccgttgatcaattggggatttgatttcccgactaaa
gttttagcggaagctactggaattcgggttaatttggttaatgtcaaggacttgttgaga
gcaggcaaaattgacgaagtagaggctgcgagattacaaaagcaaaatcaattagaaatt
agaaatgcaagagcggcattggtgttgaaaaggataaccgataaactcacaggaaatgat
attaaacgattaaaaggtttggatgttccaacgcaagtggacaaattgatacaacaagct
accagtgttgagaatttgtgtcagcactacattggatggtgttctttttggtaa

DBGET integrated database retrieval system