KEGG   Lodderomyces elongisporus: LELG_02468Help
Entry
LELG_02468        CDS       T01116                                 

Definition
similar to GM10438p
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
lel  Lodderomyces elongisporus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 477 aa AA seqDB search
MLQRGPETMREQAFANAFGRDLADAFEWVMNFKRTNDVTNLNPAWDIYYNVFRRITRQLP
QLVSLELQFVSPMLEKAHNLELALPGTYEAGKPIIRIVKFDPTFSVISSKQRPRKLSIRG
SNGKDYQYVLKGHEDIRQDNLVMQLFGLVNTLLVNDPECFKRHLDIQRYSAIPLSPKVGL
LGWVPNSDTFHMLIKGYRESRSIMLNIEHRLLLQMAPDYDILTLLQKVEVFTSALDNTRG
QDLYKVLWLKSKSSEAWLDRRTTYTRSLAVMSMVGYILGLGDRHPSNLMLNRTTGKVIHI
DFGDCFEAAILREKYPEKVPFRLTRMLNYAMEVSGIEGSFRITCEHVMRVLRDNKESLMA
ILEAFAYDPLINWGFDFPTKVLAEATGIRVNLVNVKDLLRAGKIDEVEAARLQKQNQLEI
RNARAALVLKRITDKLTGNDIKRLKGLDVPTQVDKLIQQATSVENLCQHYIGWCSFW
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaacgtgggccagaaactatgcgagagcaagcatttgcaaatgcgtttggccgt
gatttggcagatgcgtttgaatgggtgatgaactttaaaagaaccaatgatgtaacaaac
ttgaatcccgcctgggatatatattacaatgtctttagaaggatcacaaggcaattacca
cagcttgtgagtcttgagttacaatttgtatcgccaatgcttgaaaaggctcataatttg
gaattggcgttgccgggtacttatgaagcaggaaagccaattatacgaattgtcaagttt
gacccaacattttctgtgatttcatcaaagcaaagacctaggaagctatctattcgagga
agcaatggtaaagattatcaatatgtgttgaaaggtcacgaggatattaggcaggataat
ttggtcatgcaattgtttgggttggtaaacactcttttggtcaatgatccagagtgtttc
aagagacatttggacatccagcgatattcggcaatacctttgtctcccaaagtaggttta
cttggttgggttcctaatagtgatactttccatatgctcattaagggttatagagaatca
agaagtattatgttgaatattgagcatcgtcttttactacaaatggctccagactatgat
attctcacgctattacaaaaagttgaggtatttacaagtgcattagataatacaagagga
caagatttgtacaaggtgctttggctcaagtcgaagtcttctgaagcatggttggatcgc
cgtacaacatacacaagatcattagctgtgatgtctatggttggttatatattgggattg
ggcgataggcacccatccaatttgatgttgaatagaactacaggtaaagttatacacatt
gattttggtgattgctttgaagcagcaatccttcgagaaaagtaccctgaaaaggttcca
ttcaggttaactaggatgttgaattatgcaatggaggtaagtggtattgagggttcattc
cgaattacatgcgaacatgtcatgcgggtgttgcgggacaataaagaatctttgatggcg
attttggaagcatttgcatatgacccgttgatcaattggggatttgatttcccgactaaa
gttttagcggaagctactggaattcgggttaatttggttaatgtcaaggacttgttgaga
gcaggcaaaattgacgaagtagaggctgcgagattacaaaagcaaaatcaattagaaatt
agaaatgcaagagcggcattggtgttgaaaaggataaccgataaactcacaggaaatgat
attaaacgattaaaaggtttggatgttccaacgcaagtggacaaattgatacaacaagct
accagtgttgagaatttgtgtcagcactacattggatggtgttctttttggtaa

DBGET integrated database retrieval system