KEGG   Lodderomyces elongisporus: LELG_02490Help
Entry
LELG_02490        CDS       T01116                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase 1
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00010  Glycolysis / Gluconeogenesis
lel00620  Pyruvate metabolism
lel00640  Propanoate metabolism
lel00680  Methane metabolism
lel01100  Metabolic pathways
lel01110  Biosynthesis of secondary metabolites
lel01130  Biosynthesis of antibiotics
lel01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LELG_02490
   00620 Pyruvate metabolism
    LELG_02490
   00640 Propanoate metabolism
    LELG_02490
  Energy metabolism
   00680 Methane metabolism
    LELG_02490
Enzymes [BR:lel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LELG_02490
Lipid biosynthesis proteins [BR:lel01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LELG_02490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 5233359
NCBI-ProteinID: XP_001525932
UniProt: A5DYQ3
AA seq 689 aa AA seqDB search
MPEQKNTLQKQSQSHISLDHEKMQQPPQGFFDRQPNGQEPNLKDFATYQKLYNQSIQDPN
AFWTKQAQEYLHWSKPFEVARFPQDPKDDFKNGDLPAWFINGELNACYNAVDRWALKNPN
KPAIIYEADEVGEGRIITYGELLKEVSKLAQVLVKLGVKKGDSVAVYLPMIPEAIVTLLA
IVRIGAMHSVVFAGFSSASLRDRILDADSKIVITADESKRGGKTIETKKIVDGALKECPD
VRNVIVFKRTGNPHVPFDNSNGRDLWWHEEMAKNGSYFPPTPMNAEDPLFLLYTSGSTGK
PKGVQHTTAGYLLGALMTTKYTFDVHEDDILFTAGDIGWITGHTYCVYGPLLNGATSVVF
EGTPAYPNFSRYWEIVDKYKVNQFYVAPTALRLLKRAGTKYIENYDLGSLRVLGSVGEPI
AAEVWHWYNDNIGRGKAHIVDTYWQTESGSHLLTPLAGITPTKPGSASLPFFGVEPKILD
PTTGAELKDNDVEGVLAIKQAWPSITRGIYNDYNRFIDTYLAPYPNHYFSGDGAARDLEG
FYWILGRVDDVVNVSGHRLSTAEIEAALIEHQLVAESAVVGYADELTGQAVAAYVALKKD
KLPANTTEEDLELIKKELVLTVRKEIGPFAAPKLILLVDDLPKTRSGKIMRRILRKVLAG
EEDQLGDTSTLSNPQVVQQIIDIVHKSKK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacaaaaaaatactctgcaaaaacaatctcagtctcatatttccttggaccat
gaaaagatgcaacaaccaccacaaggatttttcgacagacaaccaaatggccaagagcca
aacttgaaggactttgccacctaccaaaaattgtacaatcaatcgattcaagacccaaat
gcattttggactaaacaagctcaagaatacttgcactggtctaaaccatttgaagttgct
agattcccacaagaccccaaggatgactttaaaaatggagacttgcccgcttggtttatc
aatggtgaattgaatgcatgctacaatgcagttgaccgctgggcattgaagaaccccaac
aagccagcaattatctatgaggctgacgaggttggagaaggcagaataatcacttatgga
gaattgttgaaggaggtttccaaattggcccaggttttggtcaagttgggtgtcaagaag
ggcgactcggttgcagtgtacttgccaatgattccagaggctatcgttacattgttggct
attgtccgtattggtgccatgcactctgtggtttttgccggcttttcttcagcctctttg
cgtgaccgtatcttggatgccgactctaagattgttattaccgctgacgaatccaagaga
ggtggaaagactattgaaacaaagaagattgtggatggcgcattgaaggaatgcccagat
gtacgcaatgttattgtgtttaagagaactggtaacccacacgtgccatttgacaattcc
aacggaagagacttgtggtggcacgaggagatggccaagaatggctcttatttcccacca
accccaatgaatgccgaagacccattgtttttgctttatacctcgggctctaccggtaaa
cccaagggtgtccaacacaccactgccggttacttgttgggtgcactcatgactacaaag
tatacctttgacgttcacgaagatgacattttattcactgctggtgacattggctggatt
acaggtcacacttattgtgtttacggtccattgttgaatggtgccacctctgtggtgttt
gaaggtacccctgcttatccaaacttttcaagatactgggaaattgttgacaagtacaag
gttaaccaattttacgttgctccaacggctttgagattgttgaagagggccggtaccaag
tatattgaaaactatgaccttggctcattaagagttcttggctctgttggtgaaccaatt
gcagctgaggtttggcactggtataacgacaatattggtcgtggtaaagcccatatcgtt
gacacttattggcaaaccgagtctggttctcacttgttgactccattggctggtatcaca
ccaacgaaaccaggatctgcctctttgccatttttcggtgttgaaccaaagattttggac
ccaaccactggtgctgagttgaaggataacgacgttgaaggtgtcttggctattaaacaa
gcatggccatccatcacaagaggaatctacaatgactataatcgttttatcgatacttat
ttggcaccataccctaaccactactttagtggtgatggtgcagcaagagaccttgaaggc
ttttactggatcttgggtagagtcgatgatgttgttaatgtgtctggccacagattatca
actgctgagattgaagctgctttgattgaacatcaattggttgccgagagtgccgttgtt
ggatatgctgacgaattgactggtcaagctgttgccgcttatgtcgctttgaagaaggat
aagttgccagccaatacaactgaagaagatctcgaactcattaaaaaagagttggttctc
actgtgcgtaaagagattggtccatttgctgcaccaaagttgattcttttggttgacgac
ttgccaaagactagatctggtaagattatgagaagaattttgagaaaagttcttgctggt
gaagaagaccaattgggtgacacttcaacattgtccaatccacaagttgtccaacaaatt
attgacattgttcacaagagcaagaagtga

DBGET integrated database retrieval system