KEGG   Lodderomyces elongisporus: LELG_02491Help
Entry
LELG_02491        CDS       T01116                                 

Definition
similar to uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lel  Lodderomyces elongisporus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LELG_02491
Enzymes [BR:lel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LELG_02491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 283 aa AA seqDB search
MTIDDKQTVILLKNPSTPTDPYEALLQAKNYSPKFIRLLTHEHKDKLLTKQYLTNHAFLK
DTQYFIITSQRAVEMFQECIEEIRQDAILGNHEENVVETILSKTGYTVGPATYSILKKVG
FKDVRGGIDAGNGAKLSDLIINDIKDVNTKIVFFTGEIRKDIIPKKLTTPVPCEFLGFSQ
FEEFVMYKTMERDDIIDKFQELHAEMNGQGWVIFYSPQGTRDIVKHLKQNIREGKKYWKL
GVIGPTTEEYLIANDLKPDVVAQRPDAESLCSAMIEFDTSNSQ
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagacgataagcaaacagtgattttactcaaaaatcctagtacaccaacggat
ccatatgaggctttattacaagccaagaattactctccaaaatttattcgattgctcaca
catgagcacaaggacaagctgctaacaaagcaatacctcaccaaccatgcgtttctcaaa
gacacacagtactttatcatcacatcgcagcgagcggtggagatgtttcaagaatgtatc
gaagagattagacaagatgcaattttgggcaaccatgaagaaaatgttgtggagacgatt
ttgagcaagactggatataccgtggggccagcaacgtactccatcttaaagaaagttggg
tttaaagatgtgcgtggaggtattgatgctggaaacggtgccaaactatccgatttgatc
attaatgatatcaaggatgtgaatacaaaaattgtctttttcactggtgaaattagaaaa
gatatcattccaaagaaattaactacaccagtaccgtgcgagtttttagggtttagccag
tttgaagagtttgtaatgtacaagacgatggagcgcgacgatataattgacaagtttcag
gagcttcatgcagagatgaatggccaaggatgggttatattctatagtccacaaggaact
cgcgatatagtgaagcatttgaaacagaatatccgagaaggtaaaaagtattggaagttg
ggtgttataggaccaactacagaagagtacttgatagcaaatgacttgaaaccagatgtg
gttgcacaacgaccggatgccgagagtttgtgctcagccatgatcgagtttgacacaagt
aatagtcagtaa

DBGET integrated database retrieval system