KEGG   Lodderomyces elongisporus: LELG_02499Help
Entry
LELG_02499        CDS       T01116                                 

Definition
(RefSeq) hypothetical protein
  KO
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
lel  Lodderomyces elongisporus
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lel00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LELG_02499
Enzymes [BR:lel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     LELG_02499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 797 aa AA seqDB search
MKLLYIYLLIGLACVVAANAPEKLNLLNSPGSQLQEAPSVRNEPQQDTINKNAGVAGQDK
TNQVNQDNQNNQGDQGNENLEGKEVVNKKDELDTSNIEELELPPTLSTEEFDKLTGKQLV
LVEFYSPYCHHCKDFFPKWKEAYQTFKRKYPQLSIDMRQVNCVENGDLCEREMIEFYPNM
LLYAPVLDKDGLPTGRSKNIDSFPRHLPKTAENVVKYLQESVAEYDEGAGNLPSQSRAYT
LDEMFKAISGEIDRPVFVSFWQANKKQWDSVELGGKMKFSGGCADCLHTKQVWDKLSNKI
MSIADSAHIMCQDLPELCNKLELDSFKNGKTSRAQFIMFLPKDKGTIRFDYDSRVDVDVM
KWWASKLIENSAYQLASARDVTEVMEYTKVLSHQPIAQMYPLKSKVTVLFYYDIDTVTPE
DKAVLPHMLRTLQKSPFNIQLYQGKHKRIEENLQTMGENLINYINYDENDKYEYDKALQI
ATTITGKPTIIVFKDNSLVPSIFQSFAVEDMRIYKNIEKFLETAQYPFYGELKPELVSTY
FFQNKKQKQKQKQKQDGGEEEKKDISKDDKVVVVVFVDLENLKQTDEQLYKLSLIAHEYN
FLKRKYYFNKVLEQRKDKEEVVEKLKAQNAETDKILLAMREEVPHLWGNDDVLFTFIDKP
KAKQYKYIKGWKVNPDQYEVGDAVVISRDCRYVWNKDLQGAALKNEPKQLKQVLMSLLTK
DGQLLHGGMGSSLVGKAFSFLNHVSSIGFLGYILLIIVSYFLSNYIIKIVKKRRYRAQGL
IGVNNGNNNHSFLPKKD
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgctttacatatatctactaataggattagcatgtgtcgtagctgcaaatgca
ccagagaaactaaatttgctcaactcgccaggttcacaactccaagaagcaccatctgtg
cggaatgaacctcaacaagacaccataaacaagaatgcaggtgtggctggacaggacaag
acgaatcaggttaatcaggataaccagaataatcagggtgatcaaggaaatgaaaatcta
gaaggaaaagaagttgttaacaagaaggatgagcttgatacctccaatattgaagaacta
gaactaccacccaccttgtctacggaagaatttgacaaactcactggcaagcaactagtg
cttgtggaattttattcaccctattgtcatcattgtaaggatttttttcccaaatggaaa
gaagcgtatcaaacgtttaaaaggaaataccctcagcttagcatcgatatgaggcaagtt
aactgtgttgaaaatggtgatttgtgtgagcgtgaaatgattgagttttaccccaacatg
ttgttgtatgctcccgtattggataaagatggtttgcctacaggaagatccaaaaacatt
gattcttttcctagacatttacccaagacagcagagaatgttgtcaagtatttacaagag
tctgttgcagaatacgatgaaggtgcaggcaacttaccaagtcaatcacgagcatacaca
ttggatgagatgtttaaagcaattagtggagaaattgatagaccagtatttgtttctttt
tggcaagcaaacaagaagcagtgggatagtgtggaattgggaggcaagatgaaatttagt
ggtgggtgtgctgattgtttacataccaagcaagtttgggacaagttgagtaacaagatt
atgtccattgctgattcagctcatataatgtgtcaagatttgcccgagctttgtaataag
ttggagttggactctttcaagaatggaaagacatcacgtgcccaatttatcatgttttta
cctaaagacaagggaactattagatttgattatgatagccgtgttgatgttgatgtgatg
aaatggtgggcatccaaattgattgaaaatagtgcataccagttggcttctgcaagagat
gttactgaagttatggagtatacgaaggtattgagccaccagccgattgcacaaatgtat
ccattaaagagcaaagtgacggtgttgttctactacgacattgatacagtaacgcctgaa
gataaggcggttcttccacatatgcttcgaactttgcaaaaatctccgttcaatattcaa
ttgtaccaaggcaaacataaacggattgaagagaatttgcaaacaatgggtgagaatttg
attaactacatcaattatgacgagaatgacaagtacgaatacgacaaggcattgcaaatt
gccaccacaattactggtaagccaactattatcgtgttcaaagacaattcgttggtgcca
tcaatttttcagtcttttgccgttgaagatatgagaatatataaaaatattgaaaagttt
cttgaaacggcacagtatccattttatggtgaattgaagccggagttagtttccacttat
tttttccaaaacaaaaagcaaaaacagaaacagaaacagaaacaggatggtggcgaagag
gagaagaaggacatttctaaagatgataaagttgttgttgttgtttttgttgatcttgag
aatttgaagcaaactgatgagcaattgtataagctttctttgatcgcccacgagtacaac
tttctcaagagaaagtactattttaataaagttttagagcagaggaaggataaggaggaa
gttgttgaaaagttgaaagcgcaaaatgccgaaaccgataagatcctacttgcaatgaga
gaggaagtgcctcatctttggggtaatgatgatgtgttgtttacctttattgacaagccc
aaggcaaagcaatacaagtatattaaagggtggaaagtgaacccagatcaatatgaagtg
ggagacgctgttgtaattagcagagattgtcgatatgtttggaacaaagacttgcaaggt
gcagctttaaagaatgaacctaaacaactcaagcaggtattaatgtcgctattgaccaaa
gatgggcaattactgcatggaggcatgggtagttccttggtgggaaaagcattctcattc
ctcaaccatgtttccagtatcggtttccttggctatattcttttgataattgtttcttac
ttcctcagcaattacattataaaaatagtcaagaagcgcaggtatagagcccagggtctt
attggggtcaacaacggcaataacaaccacagttttcttccgaaaaaggactag

DBGET integrated database retrieval system