KEGG   Lodderomyces elongisporus: LELG_02563Help
Entry
LELG_02563        CDS       T01116                                 

Definition
asparagine synthetase 2
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lel  Lodderomyces elongisporus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LELG_02563
Enzymes [BR:lel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     LELG_02563
Peptidases [BR:lel01002]
 Cysteine Peptidases
  Family C44
   LELG_02563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 572 aa AA seqDB search
MCGIFAAFRVQDVESFKPKALQYSKLIRHRGPDWSGNVITSKDTILCHERLAIVGLDAGA
QPIVSPDERYSLAVNGEIYNHIQLRQQFPDYKFKSLSDCEPIIPLFEKYDIEAPKHLDGM
FAWVLHDKNTDRIVAARDPIGITTLYLGKSSKSPETRYFASELKCLVEECDTIEAFPPGH
IYDSNTDKITRYYEPTWWDGSKIPETPVDYTKVRETLELAVRKRLMAEVPYGVLLSGGLD
SSLIASIAARETKKAYETAAASHNQGIDANKELSGVDNSGSLHASGGFQKLHSFAIGLPG
APDLIAAEKVAHYIGTIHHSHTFTLEEGIDALDDVIYHLETYDVTTIRASTPMYLLSRKI
KAQGVKMVLSGEGSDEIFGGYLYFANAPSAPAFHEECVKRVKNLHYADCLRANKSTMAWG
LEARVPFLDKQFLEVCMNIRPEDKLITPEHIEKYVLRKAFDTKDEPYLPDEILWRQKEQF
SDGVGYSWIDCLKDTAEKLVSDEDMKNPKPEWGDDIPQTKEAYWYRCKFDKMFNNSKAAA
STVMRWIPKAEWGCHSDPSGRYAKTHDHKVDA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatttttgcagcattcagagtccaggacgttgaatcctttaagccaaaggct
ttacaatactcaaagttgatcagacatagaggtccagattggtcgggtaatgtcatcacc
agtaaagataccatcttgtgtcacgagagattggccatcgttggtcttgatgccggtgct
caaccgattgtgtcgccggatgaaagatactcattagcagtcaatggtgaaatctacaac
cacatccaactccgtcaacaatttccagactacaaattcaagagtttgagtgactgtgag
ccaatcatcccactctttgagaaatacgacattgaagctccaaagcacctcgacggtatg
tttgcttgggtcttgcatgacaagaacacagaccgtatcgttgctgcaagagaccctatt
ggaatcaccacattgtacttgggtaaatcatcaaaatcaccagaaactagatactttgcc
tctgagttgaaatgtcttgttgaagaatgtgacaccattgaggcattcccaccgggacat
atttacgactccaacactgataagattacaagatactacgagcctacatggtgggatggt
tctaagatcccagaaaccccagttgactacaccaaggtgcgtgagactttggagttggca
gtaagaaaaagattgatggctgaggtcccatacggtgtgttgttgtcaggaggattggac
tcaagtcttattgcctctattgccgcaagggagaccaaaaaggcttatgaaactgctgct
gcatcccataaccaaggtatcgatgccaacaaggaattatcaggtgtcgacaactctggt
tccttacacgcctcgggtggtttccaaaaattgcactcgtttgccattggtttgccaggt
gcaccagacttgattgctgctgaaaaagtggcccactatattggaacaatccaccattca
cacacattcactcttgaagaaggtattgatgctcttgacgatgtcatttaccacttggag
acatacgatgtgacaacaatccgtgcatcaacaccaatgtacttgttgtcacgtaagatc
aaagcccaaggtgtcaagatggtcttgtctggtgaaggatcagatgagatctttggtggt
tacttgtactttgccaatgcaccttcggcacctgcattccacgaggaatgtgtaaagcgt
gtcaagaacttgcactacgccgactgtcttcgtgctaacaaatcaacaatggcatggggt
ttggaagcaagagttccattcttggacaagcaatttttggaagtctgtatgaacattcgc
cccgaagacaagttgatcaccccagaacacattgaaaagtacgtgttaaggaaagcattc
gataccaaagatgaaccatacttgccagatgagatcctttggagacaaaaggagcaattc
tcagatggtgttggttactcatggattgattgtcttaaggataccgccgaaaaattggtt
agcgacgaagacatgaagaaccctaaaccagaatggggagacgatattccacaaactaaa
gaagcatactggtacagatgtaagttcgacaaaatgttcaacaactcgaaagctgctgct
tcaacagtaatgagatggattccaaaagcagagtggggatgtcactcggatccatcggga
agatacgcaaagacccacgatcacaaagtagacgcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system