KEGG   Lodderomyces elongisporus: LELG_02705Help
Entry
LELG_02705        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
lel  Lodderomyces elongisporus
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    LELG_02705
Enzymes [BR:lel01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     LELG_02705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1241 aa AA seqDB search
MMYHPLESFTAMTQETQELTLHSGDNQIRSSPPPSSSSSSSSSSSSSSSSFSNWLTTDLE
LLKQQLILLTLSMSDIVNNFKQYHWRDVIKQAISISNDVIDNKDASLVAKEKIYVYQLFY
NSKEQFRDNDLAEKTQKDLSMITDIFKRLNWNNKDIEKVISILHQDLTKTGLTKQFPQMD
SNDLIRDLKLSTKNYAYPMSIKELELIKHRQENVYEECFLRSRASIEELLSHSHSSFNGD
HSSREEILKNFSRRASPEFYDNSDKSAFNEFMQKNKTEFALLKSCVQSDLTLKTLTEYFP
QYNILEIADYIKDNNLNTNENELTGGEKKTMREFITLGKQYEEILHEFPLRSESCIANWY
KRLSYACSRQVTFKNKTEKLIYESGMALTTSRRASRRSKAVDFDELQRLAESAQNIKVAK
KVLTEEEKQARAERKLEREQEKERKRLERLEQRAKNPPKPKPSEHKTDQRVSKMALEKLI
EATKHFQSVTGDRQILKEGVKRKIIPATFYTPETKVVKKTRNRQEKKNELRKKLKEEREK
KKKNLKSKSKSKSKSKQQKTTKRTYKRRKLTSLAKVPGVTEYEDSDLHSKLTLGMNIGME
SEEEEGEKEEEEEDEEEEEVEEEEETSEHISPFDPPDINSDTLVDLHGRKFFVKEFYSDF
PRVPELNFQDQDEKEVDNKEKDPKDSMTRDDDTIPYIDELGAHVIGSHEKCYRDMPISFP
QYSNKNGNPNHSHAVKVRFLLYPEHYELYILAEPKDNELDPVHEIMKIFLLHYALYFSHS
ENIKEIITGYCQKLERAVEENDFAEFMFVVDKWNLLMLYLSPNTASVEKVLNRNVDINAN
AKECLNISEIKNPQLDDLDLETFYGEICFEITSPFYQPVEIIKEGLEIKYKKETGDENEN
KKNLDNNQNETKEIIIDDAADISINNVEPPLNISEATSRHRPRNYILDFFTRLQLKSSIS
RYAVHQILCRVYARVVSTDSRKLRSYKAFTAEVYGELLPSFTSEVLEKVGLKPGQKFYDL
GSGVGNTTFQAALEFGAISGGCELMKHASKLTKLQDNLIRRHLAILGIRELDLKFALSQS
FVANEQVRRDCLECDVLIINNYLFDGELNASVGKLLLGLKPGTKIISLRNFISPRYRAQF
DTVFDYLSVVKEEMSDLMSVSWTANKVPYYISTVEATIRPEYLRGDNGMTLEYYNDCSKS
TSPLNNIREESPHSPMRNSLNADGALTPPTEHNSDPEFEKL
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atgatgtatcacccactggaaagctttactgcgatgactcaagaaactcaagaattgact
ctgcattccggtgataatcaaatccgttcatccccaccaccatcatcatcatcatcatca
tcatcatcttcttcttcttcttcttcttcattttcaaattggctgacaaccgatttggag
ttgctcaaacaacagttgatactgctgactctaagcatgtctgatattgtgaataatttc
aaacagtatcattggcgagatgtaataaagcaagcaatcagtatatcgaatgatgtaatt
gataataaggatgcaagtctagttgctaaagaaaagatatatgtttatcaactattttat
aactccaaagagcaatttcgagataatgaccttgcagagaaaactcaaaaagatttatcg
atgatcaccgacatcttcaaacgcttgaattggaataacaaggatattgagaaggtaatc
tcaatactgcatcaggacctaacaaagacagggcttaccaaacaattccctcaaatggac
tctaacgacttaattagagatttaaagctttctacaaaaaattatgcatatccgatgtca
attaaagagcttgaattaatcaagcataggcaagaaaacgtatatgaagagtgctttctt
cgttcaagagcatcgatagaggaattacttagccattcgcactcctcttttaatggagat
cattcgtcgcgagaagaaattttgaagaacttttctaggagagcaagtcctgaattctat
gataatagtgataaaagtgcatttaatgaattcatgcaaaaaaataaaacggaatttgca
cttctcaagtcttgcgtgcaaagcgacttgacgcttaaaacgcttacagagtatttcccg
cagtacaatattctggaaattgccgattatataaaagacaataatttgaatactaatgaa
aatgaactaacaggcggcgaaaagaaaacaatgagagagtttatcactttgggaaaacag
tatgaggaaattttgcacgagttcccattgcgttctgagtcctgcattgcaaattggtac
aaaagactttcgtatgcttgtagtaggcaagtaactttcaaaaacaaaaccgaaaagctc
atatacgagtctggaatggcattaactacatcaaggcgcgcttcaaggcgaagcaaggca
gttgattttgacgaattgcagagattggcagaatcggctcagaatattaaagttgcaaaa
aaagttttgacagaagaagagaaacaagctcgagctgaaaggaagcttgaacgagagcaa
gaaaaagaacggaaacgtcttgagagactcgagcaaagagcaaagaatcctcccaaacct
aaaccatctgagcataaaactgatcagcgagtttctaaaatggcgttggaaaaactaatc
gaggcaacaaaacactttcaatcagtaaccggtgatagacaaatattgaaggaaggggta
aagcgtaaaattattcctgcaacattctatacacctgaaactaaagttgtcaaaaagact
agaaatagacaagaaaagaagaatgaattgcgtaagaagttgaaagaagaaagagaaaag
aagaaaaaaaatttaaaatcaaaatcaaaatcaaaatcaaaatcgaaacaacagaaaaca
acaaaacggacatataaaaggcgtaagttgacctcgcttgcgaaagttcctggagtgact
gaatatgaagactctgatttacattcaaaactaacgctgggaatgaatattggaatggaa
tcagaagaggaggaaggagagaaagaagaggaagaagaagatgaagaagaagaagaggtg
gaggaagaggaggaaacatctgagcacatatcgccttttgatccaccagacataaattct
gatactttagttgatcttcacggtcgaaagttttttgtcaaagaattttattcggatttc
ccacgagttcccgagctaaatttccaggatcaagatgaaaaagaggtggataataaagag
aaagatccaaaggactcaatgactcgggatgatgacacaataccatatatagatgaatta
ggtgcacatgtaattggaagccacgaaaaatgttatcgggatatgccaatttcgtttccg
caatattcaaataaaaatggaaatcccaatcactcacatgcagtaaaagtgaggtttttg
ttatatccagagcactacgaactgtacatccttgccgagccaaaggataacgagttggac
ccggtgcacgaaatcatgaaaatttttcttttgcattatgctttgtatttttcacattca
gagaatattaaggaaatcatcacaggttattgccagaagcttgagcgagctgttgaagaa
aatgattttgcagaatttatgttcgttgtggacaagtggaacttgttaatgctatatctt
tctcccaacactgcatcggttgaaaaggtgttgaatagaaacgtcgacataaatgcaaat
gcaaaagaatgcctcaatataagtgaaataaaaaatcctcaattagatgatttggattta
gagacattttatggagaaatctgctttgaaattactagccctttttaccaaccagttgaa
atcataaaggaaggtttagaaatcaagtacaaaaaggaaaccggtgatgaaaatgagaac
aagaagaaccttgacaacaatcaaaacgagacaaaggagattattattgacgatgcagct
gatatatcaataaataatgttgagccaccgctaaacatttcagaggctactagtcgccat
agacccagaaattatattctggatttctttactagactacaattaaaatccagtatttct
cgatatgcagttcatcaaattttatgcagggtatatgctcgggttgtatcgacggattca
cgaaagcttcgatcctacaaagcttttactgcagaggtatacggggaactacttccttcg
ttcacgagtgaagttttggagaaagttgggctcaagcctggacagaaattttatgattta
ggttcgggagtgggaaataccacatttcaagcggcgttagagtttggcgcaataagcggt
ggatgtgagttgatgaaacatgcatcaaagctcactaagcttcaagacaaccttataaga
agacacttggcgattttaggaattagagagttagatttgaaatttgcattgagccagtcc
tttgttgcaaacgagcaagttcgacgtgactgtttagaatgcgacgtgctcataatcaac
aattatttattcgatggcgagcttaatgcgtcagttggaaagttacttcttggtttgaaa
cctggtacaaaaataatcagtcttcgaaactttattagccctagatacagggctcagttt
gacacagtttttgactaccttagcgtcgttaaagaagaaatgagcgatctcatgtccgtt
agttggacagctaataaagtgccttattatatttcaaccgttgaagcaacaataagacca
gaatatcttcgcggagataatggcatgactcttgaatactacaatgattgctcgaaatct
acaagccctttgaataacatacgcgaggagagtccacatagcccaatgagaaatagtcta
aatgcggacggtgccctgacgccgccgacggagcacaactcagaccctgaatttgagaaa
ctgtaa

DBGET integrated database retrieval system