KEGG   Lodderomyces elongisporus: LELG_02780Help
Entry
LELG_02780        CDS       T01116                                 

Definition
similar to ubiquitin-specific protease
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
lel  Lodderomyces elongisporus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 793 aa AA seqDB search
MYIAKKTTVLFILLNFTLFIQIIKVSFLNSNKLTATISTSLLVIASVYYISTQYIIPKLT
EITNNNNNPNNSDNSNYQSNNILPFNIPQLLHKMINSKYGRIGSDRFRSKKSKEHRFAMK
NGGELGGISNDGNTCFMNSVIQSLASSRQLMKFIDSYLYAEIEIDTNKTSGEKITMKSNQ
PRPELTFTNALKLLLDNVNGKYGSRGKEFTTKQLLNKMPNGPKQNFFSGYNQEDAQEFYQ
LIMGLLEKEFKKMSLSRLPTPEPEENSSSSKKETKFIDVRNLKEVISGCKKLGKLGTVYV
PAMQIDPNIDDAEHKVVPLQLITPVDGITAERVGCLTCGESGGIRYAVNSGLSLNLPTGG
HQSSSYHHSGFTLAQLLDEWIKPETIDDVNCNRCGLVQTREFLLRKLDELKGADESLLSK
LQVRITDIERELAKYQVTDEAFEKLTTKNQIKKSKKTKQIFLDRPPPLLSIHINRSQFDP
RTYMVIKNPSNVTFPAVLDLNRYIVEPNDINMDARLHMRKQDEIHQNILRSKQKANENSW
IQDGKDGVGEDKELSASNSESSASSLTASYNEKVIDTDGSPITTLDTSIPTPADTATSDS
RLFYNLKAVIVHYGTHNYGHYICYRKLRGTWWRISDESVYVVTEDEVLNGQGTFMLFYEF
DDGFKEVLQNVTDDEEEQEERLESGQVDGQKGNQERGAEGIPNADENDHGDLKSNKNNNN
NLISNGVTNNVSSASEESDVEESDRAVSEDLEYHISRSDVDMEDEDAKEPSKEEPVQERE
DAFFNVAEAQVHL
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgtacattgcgaagaagactacagttttatttatactcctcaatttcacgctattcatc
cagatcatcaaagtgtcgttcttaaactcaaataaactcactgcgacgatatcaaccagc
ctccttgtcatagcttctgtatactatatatcaacccaatatatcattcccaagttaaca
gaaatcactaacaacaacaataaccccaataactccgacaactccaactaccaaagtaac
aatatcttgccctttaacattccacagctattacacaaaatgataaactcgaaatacggt
agaataggcagcgataggtttaggtctaagaagagcaaggaacatcgttttgccatgaag
aacggaggagaattgggaggcataagtaatgatggaaatacgtgtttcatgaactctgtg
atacagtctttagcatcttccaggcagttgatgaaatttattgattcatacttgtacgcg
gagatcgaaatcgacactaataaaacgagcggcgaaaagattaccatgaaatctaatcaa
ccgagaccggaattgacgttcaccaatgcattgaaactacttctcgataatgttaatggg
aaatatggctctcgaggtaaagaatttacaacaaaacaattattgaacaaaatgccaaat
ggaccaaaacaaaatttctttagtggatacaaccaagaggatgcacaagagttttaccaa
ctcataatgggtcttttggaaaaagaatttaaaaaaatgagtcttagccgtcttccaact
ccagaacccgaggagaatagtagctcgagcaaaaaggagaccaaattcatcgacgttcga
aacttgaaagaagtgatttcgggatgcaagaagttgggcaaactaggaactgtttacgtt
ccagctatgcaaattgaccctaatatagacgatgcagagcataaagttgtaccattgcag
ttaatcacacctgtagatgggattacagccgaacgtgttggttgtttaacatgtggagaa
tcgggtggtataaggtacgctgtcaatagtgggttgagtttgaacttaccaactggtggc
caccagtcatcatcataccatcattcaggctttacactcgcgcaattattggacgagtgg
atcaagccagaaacaattgatgatgtaaattgtaatagatgcggtcttgtacagactcga
gagtttcttctacgcaaacttgacgaattgaaaggcgccgatgaaagtttgttgagcaaa
ttacaagtaagaatcacagatattgaacgagaactagccaagtaccaagtcaccgacgag
gcgtttgaaaaattgaccactaagaatcagatcaaaaagagtaaaaaaacaaagcagatt
ttcttggacagaccacctccattgcttagtattcatatcaaccgctcccagtttgatcca
agaacctatatggtgattaaaaatccaagtaatgtaacttttcccgcagtgcttgacttg
aataggtacattgtcgagccaaacgatatcaacatggatgcaagattgcacatgaggaaa
caagacgaaatacatcagaacattttgagaagcaaacaaaaggctaatgaaaattcttgg
atccaggatggtaaagatggtgttggggaagacaaagagttatctgcatccaattccgag
tcttctgcatcgtctttaaccgcttcttataatgagaaggtgattgatacagacggaagc
cctattacaacgttggacacctcgattccaactccagccgacactgctacatcagactca
agactcttttacaatttaaaagccgtcattgtgcattatggaacccataattatgggcat
tacatatgttacaggaaattacgtggaacatggtggaggatcagcgatgagtctgtgtat
gttgttaccgaagatgaggttcttaatggacaagggacattcatgttattttacgaattt
gatgatgggttcaaggaggtgcttcaaaatgtcactgatgatgaggaagagcaagaagaa
aggctagaaagtggacaggtagatggacaaaagggtaatcaagagagaggtgctgaagga
attccaaacgctgatgaaaatgaccatggtgacttgaagagcaacaaaaacaataacaat
aatctgatttcaaatggtgtcacaaacaatgtatcatctgcctcagaagaaagtgatgtt
gaagaaagcgaccgagcagtatcggaggatctggaatatcacatatcccgttctgatgtg
gatatggaagatgaagatgcaaaagagccatcaaaggaagaacccgtccaagaacgagag
gatgcattttttaacgtagcggaagctcaagtacatctttag

DBGET integrated database retrieval system