KEGG   Lodderomyces elongisporus: LELG_02819Help
Entry
LELG_02819        CDS       T01116                                 

Definition
similar to histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LELG_02819
Transfer RNA biogenesis [BR:lel03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    LELG_02819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 549 aa AA seqDB search
MPSQTKTKQKPEKERFIQCCADISLELVASLKSSKDINLNGLIIRYAKKHKLKAQPRLTD
IISSIPDQHKKYLIPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSD
FEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVDQLRKLGHSIDKVEYIIMGGTFMSLPI
DYRENFITQLHNALTGFNGKNIDEAIEFSQQSQTKCVGITIETRPDYCTETHLSDMLKYG
CTRLEIGVQSVYEDVARDTNRGHTVKAVCETFAVAKDAGYKVVSHMMPDLPNVGMERDLE
QFKEYFENPDFRTDGLKLYPTLVIRGTGLYELWKQGLYKSYNANALIDLVARILALVPPW
TRIYRVQRDIPMPLVTSGVENGNLRELALARMKDLGTLCRDVRTREVGIQEVHHKVVPDQ
VELIRRDYYANGGWETFLSYEDPKQDILIGLLRLRKASKKYTYRKEFTKQQTSIVRELHV
YGSVVPLHSRDPRKFQHQGFGTLLMEEAARIAKEEHGSLKISVISGVGVRNYYAKLGYEL
DGPFMSKAL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgccatcacagacaaagaccaaacaaaagcctgagaaggagagattcattcagtgctgc
gccgatatttctttggagctagttgcctcccttaaatcatcaaaagatatcaatttaaac
ggattaattattaggtatgccaaaaaacacaagcttaaagcacaaccacgacttacagat
atcatatcttctatccctgatcagcacaagaaatatcttattccgaaattgaaggccaag
cctgtgcgtactgcgtctggtatcgcagttgttgccgtgatgtgtaaaccacatagatgt
ccacacattgcatatacaggaaatatttgtgtttattgtcctggtggcccagactctgac
tttgagtattccactcagtcatacacaggttacgaacccacctcgatgagagcaatcaga
gccagatacgacccttatgaacaggctagagggcgtgtggatcagttgaggaaattgggc
cactcgatagataaagtggagtacatcatcatgggtggtacattcatgtcgttgcctatc
gattacagagaaaatttcataacacagttgcataatgccttgactggtttcaatggtaag
aacattgacgaagctattgaattttcacaacaatcccaaacaaaatgtgtaggtatcaca
atagaaacaagaccggattattgtacagagactcatttgagcgatatgttaaagtatggt
tgtaccagattggaaataggtgtgcaatcagtctatgaagatgttgctagagacacgaat
aggggccacacagtcaaggctgtttgtgaaacttttgccgttgctaaagatgccggttac
aaagttgttagtcacatgatgccggacttgccaaatgttggtatggaaagagatttggag
caatttaaagagtattttgagaatccggactttagaacagatggattaaaattatatcca
accttggtcattcgcggtacgggtttatacgaactctggaaacaaggcttgtacaaatcc
tataatgcaaatgcattgatcgacttggtcgccagaatattagccttggttccaccatgg
actcgtatctatcgtgtccaacgagatattcctatgccattggttacctccggtgtcgaa
aatggtaatcttagggagttggcattggcaaggatgaaggatttaggtacactgtgtaga
gatgtacgaacaagagaagttggtatacaggaggtgcatcacaaggttgtgcccgatcaa
gttgaactcatcagacgagactactatgccaacggaggttgggaaacatttttgagctat
gaagaccccaagcaggatatcttgattggattattgagactcagaaaggcaagcaagaaa
tatacttataggaaagagtttactaaacagcaaacatcgattgtgagagaattacatgtg
tatggttcggtcgttcccttgcattcaagagatccaagaaagttccagcatcaaggattt
ggtacattgttgatggaggaagctgctaggattgccaaggaggagcatggttcactgaag
attagtgttatttctggagttggtgtgagaaattattacgcgaaattaggctacgagcta
gacggacctttcatgtctaaagctttataa

DBGET integrated database retrieval system