KEGG   Lodderomyces elongisporus: LELG_02820Help
Entry
LELG_02820        CDS       T01116                                 

Definition
similar to protein kinase Pbs2p
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
lel  Lodderomyces elongisporus
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:lel04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 767 aa AA seqDB search
MSLNDSASSDAHTVDSKLLELNLNNDQQNDPHTTTNNNSANQQQNESKSDLKNSSGNAPE
GLASPPTPTPRLPTSLSASNHPLLNSDMQARLMAFQQRRSKPASEPVNAFDPNLLQPPAP
QSTAGSNSDSILETVVHNTTVETMAPSAAVDNAAKNSSTLNTENTNTGINNDNDSSNNNN
NNSNNHTANTNDYNNSTVTNSSQAPPSIAPPSLNMPDRSNPVALKLKSVNNVPVAASLGK
KPSLSQRRGMKLNTSAMPFNNPLGSPSNLSPGASTNKPINSTGVSPREESNSPFAMSMGK
QFGQNELSRRLSERKKKPNFKLNLSDSSSSTPSRNNSLGKSATPLSSDTSQRSSASSADL
KEEPQLQGLFANYSKYIDIKSGQLNFAGKASLHSKGIDFLSGSSFRVSLEEFEYLEELGR
GNYGSVLKVLHKPTKVLMAMKEVRLELDETKFTQILMELDILHKCVSPYIVDFYGAFFVE
GAVYMCIEYMDGGSLDQIFGNNIGIKDEAVLAYITESVTRGLRELKDNHNIIHRDVKPTN
ILVNSAGKVKLCDFGVSGNLVASMAKTNIGCQSYMAPERIKSTRPDDATYSVQSDVWSLG
LTILEIACGHYPYPAETYGNIFSQLSAIVDGEPPNLDPQVFSKQAQFFVKSCLNKNPDLR
PSYGALLQNPWLVEYRDKKTHLDELVQNRINELKAEKKGGNKTSATGGGAASADSIGSAG
NSNKNAAAIPAKAANSENVSSLLKGKVRAPALHRGGLQSVNRSFLNR
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaaacgattcggcatcttcagacgctcataccgttgactccaagttgctggaa
ttgaatttgaacaatgatcaacaaaatgacccccacaccacgacaaataataattccgct
aatcaacaacagaatgagtccaagagcgacttgaagaacagttcgggaaatgcacctgag
ggtcttgcttcgcctcccaccccaactccacgtttacccacatctctatcagcatctaac
caccccttgctcaatagtgacatgcaagccagattaatggcttttcagcaaagacgctca
aagcctgcttcagaaccagtcaatgcattcgatcctaatctcctacaaccaccagcaccc
cagagcactgcagggtccaatagcgactcaatccttgaaactgtggttcataatacaacc
gtggaaactatggctccctccgcagctgtcgataatgccgcaaaaaactcatcaactctc
aataccgagaatacaaatacgggtataaacaatgataacgactccagtaataacaacaac
aacaacagcaacaaccacaccgccaatacgaatgattataacaacagtacagtcacaaac
tcatcacaagctccaccatcgatagctccaccatcactaaacatgcctgaccgttccaac
ccagtggccctgaagctgaagtctgtcaataatgttccagtggctgctagtttgggtaaa
aaaccctctttatcacaaagaagaggaatgaagctaaacaccagtgcaatgccattcaat
aacccacttggctccccaagcaacttatctccaggtgcatctacaaacaaacctataaat
tctacaggagtttctcctagggaagagtctaactctccatttgcaatgtcaatgggcaaa
caatttgggcaaaacgaattgtccaggcgattatcggagagaaagaagaaaccgaatttc
aaactcaatttaagcgattcttcatcttcaacgccctcaagaaacaatagtttaggaaag
tcagcgactcctttgtcaagtgacacttctcaaagatcatcggcctcgtctgcagatctg
aaagaagaaccacaattacaaggtttattcgccaactattctaaatacattgatatcaaa
tcaggacaactcaattttgcaggtaaagcatctctacattcaaaaggtatcgatttcctg
tcggggtcctcgtttcgtgtttcgcttgaagaatttgaatacttggaagaactagggcgt
ggtaactatgggtcggtgctgaaagttttgcacaaacctaccaaagtgctcatggcaatg
aaagaagttagactcgagttggacgagaccaaattcacccagatcttgatggaattggac
attcttcataaatgtgtctcaccatatattgttgacttttatggagcctttttcgttgaa
ggtgccgtatacatgtgcattgaatacatggatggtggatcacttgaccaaatatttggt
aacaatattggtatcaaagacgaagcagttttggcgtacattacagaatccgttactaga
ggcttgagagaattgaaggataatcacaacatcattcacagagatgttaagccaaccaat
atcttggtgaattctgctggtaaagtgaaactttgtgattttggtgtttcggggaatctt
gtggcatcaatggcaaagaccaatataggatgtcaatcctacatggccccggagaggatc
aagagtacccgaccggatgatgcgacgtactcagttcaatctgatgtttggtcacttggt
ttaacgattttggaaattgcatgtggtcattacccctaccctgcagaaacatacggaaat
atcttttcacagttgagtgctattgttgatggcgagccaccaaacctagatcctcaagta
ttctccaagcaagcacaattttttgtcaaaagttgtctcaataagaaccccgatctccgc
ccgtcttatggtgctttgcttcaaaacccttggcttgttgagtatagagacaagaagacg
catctcgatgaactagtgcaaaatagaattaacgaattgaaggcagaaaagaaaggaggt
aacaagacgagtgctacaggtggtggtgctgcaagtgccgactctattggttccgctgga
aatagtaacaagaatgcagctgctattcccgccaaggctgcaaatagtgagaatgtaagt
tccttattgaagggcaaggttagggcaccggcattacacagaggtggtcttcaatcagtg
aatagaagctttttgaatcgttga

DBGET integrated database retrieval system