KEGG   Lodderomyces elongisporus: LELG_02884Help
Entry
LELG_02884        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
lel  Lodderomyces elongisporus
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LELG_02884
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     LELG_02884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 568 aa AA seqDB search
MEIIPSQKSSSRSRSRSRTRNSTANSRSTSATRRPSLSSTTRRSLSSSSLDRLTLTSTKI
DADRSIPSIDAILDNTLPAEFFKQDIIALTKALKISKWHKKSLVTLNLSINRISGALTNS
IYKIEYNDDRQDVHLPALLLRVYGKNVDELIDRDSELQTLIKLSQKRIGPRLLGIFTNGR
FEQFLEGYITLNKEQIRDEVISQMFGRRMKDLHYKIELNTEDYLQHLPTCWRLIEKWLRI
FEEEYLPGYESAGVDIKDVFMMSMDEFKDLVFDYKYWLFSKYEKDGFSSNYKFCHNDTQY
GNLLLHESFKPEDIIVDTPTSSSANLSEVALKSTTNKKDSNLVVIDFEYSGPNFPAFDVV
NHFSEWMADYHDPEKSYYIDEHRYPTKLEQLNLIKSYIEYDFQFPSSNLKTSKSAMDLLN
DDSKPQAISLLRHEIEKLFNECVYWRATVQIYWCLWGLIQNGPLKPKPDAQAQVGEKGVD
STYNITLDVDKLNLEGEVNKDGSGDDAVVAIEEAITSSDDDFDYLKYSNQKAGLILGDLL
QFGLLKGEQVEPKYKDLIKYLSVETFDM
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggagattattccttcccaaaaatcgtcttctcgatcgaggtccaggtcacggactaga
aattcaactgcgaattcgcgatcaacctctgccacaaggagaccgagcttgtcatcaaca
acacgccgctcattatctagctcctctctagacaggcttaccctcacctccacaaagatc
gatgctgatcggagcatcccttcaatagatgctatcttggacaataccttgcccgcagag
ttttttaaacaggatataatagcactcacaaaagcgttgaagattagcaaatggcacaag
aagagtcttgtcacactgaacttgagcataaacagaatttcaggtgcgttgaccaattcg
atatacaagattgaatacaatgatgatcgtcaagatgttcacttacctgcattattgctt
agggtgtatgggaaaaatgtcgacgagttaatcgaccgtgactccgagttgcaaacattg
atcaagttatcgcaaaagaggattggtcctcgactcttgggaatattcaccaacggtaga
tttgagcaattcttggagggatacataacattgaataaggagcagattagagatgaagtc
attagtcagatgtttggaagaagaatgaaggatttgcattataagattgaattgaacacc
gaagactacctgcaacatttaccaacatgctggcggttgattgagaaatggttgcgcatc
tttgaggaagaatatttacctgggtatgagtctgccggtgtagatatcaaagatgtgttt
atgatgagcatggacgagtttaaggatttggtatttgattacaagtactggttatttagc
aaatacgaaaaagatggatttagttcaaattacaagttctgtcataatgatacacaatat
ggtaatctactccttcacgagtcctttaaaccagaagatataatcgttgacacaccaact
tcgtcttcggcaaaccttagtgaagttgcactcaagtctacgacaaataagaaagattcc
aatctagttgtcattgatttcgaatattctggacccaatttcccagcatttgacgttgta
aaccactttagtgaatggatggctgattatcacgatcctgagaaatcatactacattgac
gagcacaggtacccaacaaaattggagcaattgaacttgattaaatcctatattgagtat
gatttccaattcccttcatccaatttgaaaacatcaaagtcagcaatggacttgttgaat
gatgactctaagcctcaagcgataagtttgcttcgtcatgaaattgaaaaattgtttaat
gagtgtgtttactggagagccacggtacagatatattggtgtttatggggcttgatccaa
aatggaccattgaaacctaaaccggatgcgcaagcgcaagttggcgaaaaaggtgttgat
agtacttataacattacgcttgatgttgacaagctcaacttagagggcgaagtaaacaag
gacggcagtggcgatgacgcagtagtagccatagaagaagccatcacatcgagtgacgat
gatttcgactacttgaaatattccaaccaaaaggcaggactaattttgggtgatctcttg
caatttggacttctcaaaggagaacaggtggaaccaaagtacaaagaccttatcaagtat
ctcagtgtcgaaacattcgacatgtga

DBGET integrated database retrieval system