KEGG   Lodderomyces elongisporus: LELG_03007Help
Entry
LELG_03007        CDS       T01116                                 

Definition
(RefSeq) nucleoporin GLE2
  KO
K14298  mRNA export factor
Organism
lel  Lodderomyces elongisporus
Pathway
lel03013  RNA transport
Brite
KEGG Orthology (KO) [BR:lel00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LELG_03007
Messenger RNA biogenesis [BR:lel03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     LELG_03007
Chromosome and associated proteins [BR:lel03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    LELG_03007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 Nucleoporin_N eIF2A WD40_like Frtz
Motif
Other DBs
NCBI-GeneID: 5233015
NCBI-ProteinID: XP_001526449
UniProt: A5E070
AA seq 369 aa AA seqDB search
MSFLTASSAPTSTTSAATGQELMNDITINNGPEDSIEDISFSPQQDLLAVASWDKKVRIY
EIDSNTGNNQGKAMYEHSAPVFSSRWSTDGTKVVSGGADNQVKIFDLATQQQQQIGQHDA
PVRAVRYVECGPTNTPVVASGSWDKTLKYWDMRTPNPVSTINLPERCYTMDSSQKLLVVG
CAERHISIIDLNNPQAIWKTSQSPLKWQTRTIACYPQANGFAVGSIEGRCAIQYINDSEQ
KKFGFSFKCHRKSGSSTSTTGVRTTSSTSESQAYPVNAISFHPIYGTFSTAGSDGTFCFW
DKDAKQRLKLFPELPGTVSATAFNKNGTIFAYAVSYDWSLGYMGNRPDYPNIVKLHATKD
VEIKQKNKR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcctaactgcatctagtgctccaacatccactacgagtgcagccacgggccaa
gagctcatgaatgatattaccatcaacaatggtcccgaggattcaattgaagatatttca
ttctcaccacaacaagatctcttggctgttgctagttgggataaaaaagtgagaatctat
gagattgattcaaacacagggaacaatcaggggaaggccatgtatgaacacagtgcaccc
gtgttttcgtcacggtggtccactgatggtacaaaggttgttagtggaggagcagataat
caagtcaaaatattcgacttagcaacacaacaacaacagcaaattggacagcacgatgca
ccagtgagggcagtaagatacgttgagtgtggcccaacaaataccccagtggttgccagt
ggatcgtgggataagaccttaaagtattgggacatgagaacgccaaaccctgttagtaca
atcaacttaccagagcggtgctacacgatggattcatcacagaaactattggttgtgggc
tgtgcagagaggcatatcagtataatagacttgaacaatccacaagcaatttggaagact
agtcaatctcctttgaaatggcagacaagaacaatagcatgctacccacaagcaaatggg
ttcgctgtgggttcaattgaaggtcgttgtgcaatccaatacattaatgacagcgagcag
aaaaagtttggattttcattcaagtgtcacagaaaatctggatctagtacatcaacaaca
ggagttcgaacgacatccagtactagcgagtcacaagcctaccctgttaatgccatttca
ttccatcctatatacggtacctttagtactgcagggtcagatggaacattttgtttctgg
gacaaggatgcaaaacaaagattaaaactgtttccagaattgccaggtactgtttcagct
accgcttttaataagaatggtacgatatttgcctatgcagttagttacgactggtcgcta
ggctacatgggtaatagaccagactatccgaacattgttaaattacacgcaacaaaagat
gtggaaatcaaacagaagaacaagaggtaa

DBGET integrated database retrieval system