KEGG   Lodderomyces elongisporus: LELG_03007Help
Entry
LELG_03007        CDS       T01116                                 

Definition
nucleoporin GLE2
Orthology
K14298  
mRNA export factor
Organism
lel  Lodderomyces elongisporus
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:lel03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 369 aa AA seqDB search
MSFLTASSAPTSTTSAATGQELMNDITINNGPEDSIEDISFSPQQDLLAVASWDKKVRIY
EIDSNTGNNQGKAMYEHSAPVFSSRWSTDGTKVVSGGADNQVKIFDLATQQQQQIGQHDA
PVRAVRYVECGPTNTPVVASGSWDKTLKYWDMRTPNPVSTINLPERCYTMDSSQKLLVVG
CAERHISIIDLNNPQAIWKTSQSPLKWQTRTIACYPQANGFAVGSIEGRCAIQYINDSEQ
KKFGFSFKCHRKSGSSTSTTGVRTTSSTSESQAYPVNAISFHPIYGTFSTAGSDGTFCFW
DKDAKQRLKLFPELPGTVSATAFNKNGTIFAYAVSYDWSLGYMGNRPDYPNIVKLHATKD
VEIKQKNKR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcctaactgcatctagtgctccaacatccactacgagtgcagccacgggccaa
gagctcatgaatgatattaccatcaacaatggtcccgaggattcaattgaagatatttca
ttctcaccacaacaagatctcttggctgttgctagttgggataaaaaagtgagaatctat
gagattgattcaaacacagggaacaatcaggggaaggccatgtatgaacacagtgcaccc
gtgttttcgtcacggtggtccactgatggtacaaaggttgttagtggaggagcagataat
caagtcaaaatattcgacttagcaacacaacaacaacagcaaattggacagcacgatgca
ccagtgagggcagtaagatacgttgagtgtggcccaacaaataccccagtggttgccagt
ggatcgtgggataagaccttaaagtattgggacatgagaacgccaaaccctgttagtaca
atcaacttaccagagcggtgctacacgatggattcatcacagaaactattggttgtgggc
tgtgcagagaggcatatcagtataatagacttgaacaatccacaagcaatttggaagact
agtcaatctcctttgaaatggcagacaagaacaatagcatgctacccacaagcaaatggg
ttcgctgtgggttcaattgaaggtcgttgtgcaatccaatacattaatgacagcgagcag
aaaaagtttggattttcattcaagtgtcacagaaaatctggatctagtacatcaacaaca
ggagttcgaacgacatccagtactagcgagtcacaagcctaccctgttaatgccatttca
ttccatcctatatacggtacctttagtactgcagggtcagatggaacattttgtttctgg
gacaaggatgcaaaacaaagattaaaactgtttccagaattgccaggtactgtttcagct
accgcttttaataagaatggtacgatatttgcctatgcagttagttacgactggtcgcta
ggctacatgggtaatagaccagactatccgaacattgttaaattacacgcaacaaaagat
gtggaaatcaaacagaagaacaagaggtaa

DBGET integrated database retrieval system