KEGG   Lodderomyces elongisporus: LELG_03013Help
Entry
LELG_03013        CDS       T01116                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
lel  Lodderomyces elongisporus
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    LELG_03013
Enzymes [BR:lel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     LELG_03013
Glycosyltransferases [BR:lel01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   LELG_03013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 796 aa AA seqDB search
MSTSAQPHETKVKLTKSSGSSNNNNNSSSSSNRAKVASIDAKYSDDELSSDESIEDTADA
LADGDIDLAEKTKRTQYDETKETIESLKKLEAILAPIFFTLLSFFVRFYRISVNSSVVWD
EAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEKYPEYIDYTKMR
LFNATFSALCVPLAYFTMKEIGFTVWTTWLFTLMVCLESSYVTLGKFILLDSMLLFFTVS
TVFCFARYNNFNNKQQEFGRKWWKWLLLTGVSIGCVCSVKMVGLFVTSLVGIYTVVDLVT
KLQDKSISWKKYACHWSARIIGLIIVPMSIFLLCFKIHFDLLYKSGTGDANMSSLFQANL
ANSDVGGGPRDVSIVHSVVTLKNQGLSGGLLHSHVQTFPEGSKQQQVTTYSHKDSNNNWI
FQRARPLPSYDPSANKTDIEYVIDGMHVRLMHPQTGRNLHTHEIPAPSTKSEWEVACYGN
LTIGDAKDNWIVEIMDQQGDEDKLKLHPLTSSFRLKNEVLGCYLGVTGTSLPQWGFRQGE
VVCYKNPFKKDKRTWWNIENNRNEILPPAPENFKLPKTRFIRDFIQLNLAMMATNNALLP
DPDKQDDLASSFWQWPTLNVGIRMCGWSPDKAKYFMIGSPATTWTSTVGVFIFAFITLYY
IVRWQRQFVDFPSNHPQKLQKFIMGGIYPMFGWGLHFMPFVIMGRVTYVHHYVPALYFAM
IVFCYEVDAFASIFNRPRASAVSKIVYAAIYVTLYALVAGTFWYLRYFSWGMEGDKKEWK
HLQLINSWRVSDDNYI
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacttctgctcaaccccatgagacaaaagtcaaattgacaaaatcatcaggcagc
agtaacaacaacaacaacagcagcagcagcagcaatagggccaaagttgcctcaattgac
gcaaaatactctgacgacgaactttcaagcgatgaaagtatcgaggatactgctgacgct
ttggctgatggagatatagatcttgctgaaaagacaaagagaactcagtacgacgaaacc
aaagagaccattgaatcgttgaaaaagttggaagcaatcttggcacccatcttcttcacc
ttgttatcattctttgtgcgtttctacagaatctcagtcaactcgagtgttgtttgggac
gaggcacactttggtaagtttggttcttattacttgagacacgagttttaccacgacgtg
cacccaccattgggcaagatgctcgtgggtctctctggatacttggctggatacaatggc
tcatgggatttccccagtggtgaaaaataccctgaatacattgactatacaaaaatgaga
ttgttcaatgccaccttttcggcattgtgtgtacccttggcttatttcacaatgaaggaa
attggcttcaccgtttggacaacatggctattcacattgatggtttgcttggaatcgtca
tatgtgaccttgggcaaatttatccttttggactctatgttgttgttctttactgtatcc
acagtcttttgctttgcacgctacaacaactttaacaataagcaacaagagtttggaaga
aaatggtggaaatggctcttgttgaccggcgtctccattggatgcgtgtgttcagtaaag
atggttggattgtttgtcacatccttggttggtatttacaccgttgttgatcttgtcact
aagttgcaggacaagtcaatttcttggaagaagtatgcatgtcattggagtgccagaatt
attggtttgatcattgtgccaatgtccatctttttactttgctttaagatccattttgat
ttattgtacaagtcgggaactggtgacgccaatatgtcctctttattccaagccaacttg
gccaactcagatgttggtggtggtccaagagacgtttccattgtccactctgtggttaca
ttgaagaaccaaggcttatcaggcggcctcttgcattcacacgttcaaactttccccgaa
ggttctaagcaacaacaagttacaacctatagccacaaggactccaacaacaattggatt
ttccaaagggctagaccattgccttcttatgatccaagtgctaacaaaaccgatattgaa
tacgttattgatggaatgcacgtgaggttgatgcacccacaaactggtagaaatttgcat
actcacgagattccagccccatccaccaaatcagagtgggaagttgcatgttatggtaac
ttgaccattggagatgccaaggataactggattgttgagattatggatcaacaaggtgac
gaagacaagttgaaattacatccattaacttcatcattcagattgaagaatgaagtcttg
ggctgttacttgggtgttaccggaacctctttaccacaatggggtttcagacagggtgaa
gttgtttgctacaagaacccattcaagaaggacaagagaacttggtggaacattgaaaat
aatagaaatgaaatcttgccaccagcaccagagaattttaaattacccaaaactagattt
attcgtgatttcattcagctcaatttggcaatgatggccactaacaatgcgttattgcca
gatccagacaagcaagatgacttggcctcgtcattttggcaatggccaaccttgaatgtt
ggtattagaatgtgtggatggagtcccgataaggccaaatactttatgattggctcccca
gcaactacatggacctccaccgtgggtgtctttatttttgcatttatcacattatactac
attgttagatggcaaagacaatttgttgatttcccttccaaccatccacaaaagttgcaa
aagttcattatgggtggaatctatccaatgtttggctggggtttgcactttatgcccttt
gtcattatgggcagagttacatatgtccaccactatgtgccagccttatattttgccatg
attgtgttttgttatgaggttgatgcatttgcatctatcttcaataggccacgtgcatct
gctgtcagtaaaattgtatatgcagcaatttatgtgacgttgtatgctcttgttgcagga
actttctggtacttgaggtatttctcatggggtatggaaggtgacaaaaaggagtggaag
catttgcaattgatcaactcatggagagtttcagatgataactatatataa

DBGET integrated database retrieval system