KEGG   Lodderomyces elongisporus: LELG_03023Help
Entry
LELG_03023        CDS       T01116                                 

Definition
histone deacetylase RPD3
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     LELG_03023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 576 aa AA seqDB search
MYQQLPFDELKVDPTQKKRIAYFYDADIGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKM
EIYRAKPATKQEMCQFHTDEYIDFISRVSPDNLDLFAKESVKFNVGDDCPVFDGLFEYCG
ISGGGSMEGAARLNRGKCDIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVL
YIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGVGKGKYHSVNVPLRDG
IDDATYKSVFEPLISKIVEWYQPSAIVLQCGGDSLSGDRLGCFNLSMEGHANCINFVKSF
NIPLMVLGGGGYTMRNVARTWAFESGLLNNVKLPQELPYNEYYEYYAPNYTLEVRNSNMY
NQNSPEFLDKIMTSILTNLENTKHAPSVQMNVVPNDPEDLGDVEEDTAIALDTKGGSEMA
RDAQIQPDNEYYDEDDKDKGERNVNLNEVDKDDTMQIDNNDTIEAKEEEEDDDDDEKKKK
KKKEEEEKGEKEKVVGNGSGHAETSGLETEDAMEVDSAPASTLAPTQGSTQGSTPAPVTT
NEVTGANVSNGENKANGAPTLTEEELKEIQELNESL
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaacaactcccgtttgacgagctcaaggttgaccccacgcagaagaaacgcata
gcctacttctacgatgccgatattggtaattatgcctatggtgccggtcaccctatgaaa
ccgcatcgtattagaatggcccattccttgatcatgaactatggcctttataaaaagatg
gagatctatcgagccaagcccgcgacaaagcaggagatgtgtcagttccacaccgatgaa
tatattgattttataagtcgtgtctcacccgacaatcttgacttgtttgccaaggagagt
gtgaagttcaatgttggtgacgattgtccagtttttgatggattatttgagtattgtggg
attagcggtggtggatcaatggagggtgcagccagattgaaccgaggcaaatgtgatatc
gcgataaactatgctggtgggttgcaccatgccaagaagagtgaagcttctggcttttgt
tatttgaatgatattgtattgggaattattgagttgttgaggtatcacccgagagttttg
tatattgatatcgacgtgcatcatggtgatggtgttgaagaagctttctacacaaccgat
agagtcatgacctgttcgtttcacaaatatggtgagtttttccctggaactggtgaattg
agagatattggtgttggtaaggggaaataccatagtgttaatgttccacttcgagatgga
attgatgatgctacgtataagtcagtgttcgagccattaattagcaagattgttgagtgg
tatcaaccctcagctattgttttgcaatgtggtggtgattccttgagtggcgatcgttta
ggttgctttaacttgtcaatggaggggcatgcaaactgtatcaactttgtcaagtcattt
aatataccattgatggttttgggtggtggtggatacacaatgagaaatgtggcgagaact
tgggcgtttgagtctggattgttgaataatgtcaagttgccacaagagttgccgtataat
gagtattacgagtactatgctccaaactatacattggaagtgaggaactcaaacatgtat
aaccagaactcgcccgaatttttggataagatcatgaccagtatattgacgaatttggag
aatacaaagcatgcaccatcggtgcagatgaatgtggtgcccaatgatcccgaggacttg
ggtgatgttgaggaggatacggcgattgctttggatacgaaaggtggttctgaaatggct
cgcgatgcacaaatacagccggataatgagtattatgatgaagatgataaggacaaagga
gaaagaaatgtgaatttaaatgaagttgataaggatgacactatgcaaattgataacaat
gacactattgaagctaaggaagaagaagaagatgatgatgatgatgagaagaagaagaag
aagaagaaggaggaagaggagaaaggagaaaaagagaaggttgttggaaatggaagcggg
catgcagaaacgtcaggacttgaaacagaagatgcgatggaggtggatagtgcaccagca
tcaaccctggcaccaacacagggatcaacacagggatcaacaccagctccagtaaccact
aatgaagtgactggggccaatgtatcaaatggtgaaaataaagccaatggcgctcccaca
ttgactgaagaggagttgaaggaaattcaagagttgaatgagagtttgtaa

DBGET integrated database retrieval system