KEGG   Lodderomyces elongisporus: LELG_03030Help
Entry
LELG_03030        CDS       T01116                                 

Definition
NADH-ubiquinone oxidoreductase 20 kDa subunit
Orthology
K03940  
NADH dehydrogenase (ubiquinone) Fe-S protein 7 [EC:1.6.5.3 1.6.99.3]
Organism
lel  Lodderomyces elongisporus
Pathway
Oxidative phosphorylation
Metabolic pathways
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:lel00190]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 224 aa AA seqDB search
MNSLTRNIAYRLLKQQTRSSSYLVSSISHIPQQSNNTPVASKRYVSSKELTPKELPTDFP
LMSQKTASSAVDYALTSLDTIANWARKSSFWPVTFGLACCAVEMMHVSAPRYDQDRLGII
FRASPRQSDIMIVAGTLTNKMAPALRQVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRG
CDRVVPVDIYVPGCPPTAEALMYGVFQLQKKMMKTRITRLWYRS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaattcattgacaaggaacattgcttacaggctgttgaagcaacagactagatcgtct
tcgtacctcgtatcatcgatttcacacattccacaacaaagcaataacacaccagttgca
tccaaacgttatgtatcctctaaggaattaacgccgaaggagttgccaaccgactttcca
ttaatgtcacaaaagactgcctctagtgcagtggattatgccttgacatcattagacaca
attgccaactgggctagaaagtcttccttttggcccgtgacatttggtttggcatgttgt
gccgtggagatgatgcatgtctcagcaccaagatacgatcaagatagattgggtattatt
ttcagagcctcacctcgtcaatcggatattatgattgttgctggtacattaactaacaag
atggcgccagcattgagacaagtctacgatcaaatgcctgatcctaaatgggttatcagt
atgggttcatgtgccaatggtggtggttactaccattattcgtactcagttgtgagaggt
tgtgacagagttgttccagtcgatatctatgttccaggatgtccacctacagcggaagct
ttgatgtatggtgtctttcaattgcaaaagaagatgatgaagaccagaatcaccaggttg
tggtacagaagttag

DBGET integrated database retrieval system