KEGG   Lodderomyces elongisporus: LELG_03030Help
Entry
LELG_03030        CDS       T01116                                 

Definition
NADH-ubiquinone oxidoreductase 20 kDa subunit
Orthology
K03940  
NADH dehydrogenase (ubiquinone) Fe-S protein 7 [EC:1.6.5.3 1.6.99.3]
Organism
lel  Lodderomyces elongisporus
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    LELG_03030
Enzymes [BR:lel01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     LELG_03030
   1.6.99  With other acceptors
    1.6.99.3  NADH dehydrogenase
     LELG_03030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 224 aa AA seqDB search
MNSLTRNIAYRLLKQQTRSSSYLVSSISHIPQQSNNTPVASKRYVSSKELTPKELPTDFP
LMSQKTASSAVDYALTSLDTIANWARKSSFWPVTFGLACCAVEMMHVSAPRYDQDRLGII
FRASPRQSDIMIVAGTLTNKMAPALRQVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRG
CDRVVPVDIYVPGCPPTAEALMYGVFQLQKKMMKTRITRLWYRS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaattcattgacaaggaacattgcttacaggctgttgaagcaacagactagatcgtct
tcgtacctcgtatcatcgatttcacacattccacaacaaagcaataacacaccagttgca
tccaaacgttatgtatcctctaaggaattaacgccgaaggagttgccaaccgactttcca
ttaatgtcacaaaagactgcctctagtgcagtggattatgccttgacatcattagacaca
attgccaactgggctagaaagtcttccttttggcccgtgacatttggtttggcatgttgt
gccgtggagatgatgcatgtctcagcaccaagatacgatcaagatagattgggtattatt
ttcagagcctcacctcgtcaatcggatattatgattgttgctggtacattaactaacaag
atggcgccagcattgagacaagtctacgatcaaatgcctgatcctaaatgggttatcagt
atgggttcatgtgccaatggtggtggttactaccattattcgtactcagttgtgagaggt
tgtgacagagttgttccagtcgatatctatgttccaggatgtccacctacagcggaagct
ttgatgtatggtgtctttcaattgcaaaagaagatgatgaagaccagaatcaccaggttg
tggtacagaagttag

DBGET integrated database retrieval system