KEGG   Lodderomyces elongisporus: LELG_03183Help
Entry
LELG_03183        CDS       T01116                                 

Definition
mitogen-activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LELG_03183
Protein kinases [BR:lel01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   LELG_03183
Exosome [BR:lel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LELG_03183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 393 aa AA seqDB search
MTATSVITKANKVRHAYRKPQPDPSTRKIVFNISPNFKVESVLGEGAYGIVALAVHLPTK
TKVAIKKIEPFERPLFCLRTLREIKLLRKFNNHENIIRLYDLQKPSSFATFNEVYLIQEY
MPSDLHNIIQTHVLSDQHVQFFIYQILKGLKLIHSAKVIHRDLKPSNILVNENCDLKICD
FGLARVDSVNYRTDKISSLTEYVATRWYRAPEIMLNVSNYTTAIDLWSVGCILFELLIYR
AIFPGADYINQLKLIFEILGTPSEDDLKVIKSKRARTFIQSLPVRQKVNLTEFVQLHPCR
RAKHHEFAGEVNPMAIDLLEKLLVFDPSRRITVTEALEHPYLSTYHDPLDEPVTLPVRLE
DFDFDVEKKDLDLDDLKRQIYNQIVESKRIETN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacagccacttcagtgattactaaagcaaacaaagtacgacacgcatataggaaacct
caaccagatccttcaacaagaaagattgtatttaacatctcgcccaatttcaaagtcgaa
agcgtattaggagaaggagcttatggaatagtggctttggctgtgcatttgcctaccaag
accaaagtggcaattaaaaaaattgaaccgtttgagagaccgcttttttgtcttcgaaca
cttcgagaaatcaagttgcttcgcaaattcaataatcacgagaatataataaggctttat
gatttacaaaaaccaagcagctttgcaacatttaatgaagtttaccttattcaggaatat
atgcctagcgatttgcacaacattatacagacacacgtactaagtgatcagcacgttcaa
ttttttatctatcagattttgaaaggactcaaattgatacacagtgctaaagtcattcac
cgtgatttaaagccctcaaacatcctcgtgaatgagaattgtgatttgaaaatatgtgac
tttggtcttgcaagggtcgactcggtcaattatcgcacagataaaatttcatcgcttacg
gaatatgtggctacgagatggtatagagctccagaaattatgctaaatgtctcaaactat
acaactgcaatcgacttgtggtctgttggatgcattctatttgaattattgatctacaga
gctattttcccgggtgctgactatattaatcaattgaaattgatctttgagattttaggt
acaccatcagaagatgatctcaaagttatcaaatccaagagggccagaacatttatccaa
tcacttccagttagacaaaaagttaacctcaccgagtttgttcagcttcatccatgtcga
agagcaaaacaccatgaatttgcaggcgaagtgaaccccatggcaattgatttacttgag
aaactactagtgtttgacccaagcaggaggataaccgtaacagaggctttggaacaccca
tatttatcaacttatcacgatccactagacgagccagtaacgctgcctgtgcgtttagaa
gattttgattttgatgtggaaaaaaaggatttggatttggatgatttaaagagacaaata
tataatcaaatcgtagaatccaaaagaattgaaacaaattaa

DBGET integrated database retrieval system