KEGG   Lodderomyces elongisporus: LELG_03186Help
Entry
LELG_03186        CDS       T01116                                 

Definition
similar to ubiquitin-specific protease.
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LELG_03186
Peptidases [BR:lel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LELG_03186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1377 aa AA seqDB search
MYDEIDLEKRLSLHLDPNFSTNNLNSNLDDEQALSSNSELAKIQTQMQPPTQVGEQTEKQ
KQTVGLSRNPFRNASSAFDELENPTELLTSEEIEKTTQLFTQPQSGQYSMQEEVATPATI
STDFTMTGPKLTPQELKLYPFKTLNRILDDLKWTVPYKEKFGQSLLNTRPIEYSESLPAL
VGSCRTVPELCIMNEMIDFCPAIQKFEFFDGKQIVNLIRGVIISTNKEIYHFRIMILQDN
TNPFVVNVVDKHQYHVIPESHVSDVEKELLSTLLLERNDTEETAVIDDAFFKSLSAPNNN
ILRVTIIKSEFNQEDLKSLFDPQAIKERYLASLPRHPDLDASRIPKAQQCVNMLIKVLKG
PILLGDQNVRVISLNTSLDAHVDVSFLIENLGFTLDRERNEVSPPKLIDSHFLLESYIRK
ALELIIIAQTLPPENNIARISYSFSTNLNKVFDVIAEVDKKESTTNFTSNFANRNKSFIQ
LSISGHFTDDLIIKCFESTMQSNPENKLFYIDALKDVKSIRQSAGTSYNSKLTLYINKKL
HAGDFVGYKDLIESLKILGIEVDPSYTDARLLDDDAIIAAYQTHFKDDPRNYQYYNKQLK
SVAIAKNSQRIRDYLAGEILPMSLALFELEIEEITEDDVVITAFEFKLEDILQRNGFDKT
ASEVVLLTRAFASIAIQRKSYLLLNYLEQKLPEYASVPQETRYGETLLSRSYELLGALDS
NSDFELVSIFQSVLSTSSIDIRVLRRAFRSIANSRNSQVMQTFLETGKIDSQLLPAENWP
AGLDNIGNTCYLNSLLQYYFCIKPLRDLILNFDEDKIDTGLISNERKIGGRVVEEAEIKR
AYQFIYHLKSLFHEMIHTNSRCVKPSRELAYLSFLPSSLPVTFVDGNELGAKKSENAEQD
MDTEMEDADVTIVEHQEYSMGNTEYKDNLVDDHNTASSLLSNFDTDSLEEPETLVTSGEP
NKEFDDFVEGKVVKFENADQPNDDEDEDDVVVETKQIENIHNDQYRDKETNNLLDDRYVD
SRILPISADEMESTIELGRQQDVTECIENVLFQIESALPPTSLDEDNEQNDMVKELFYGK
TKQVIQPLQGDSLQTRTSVERFNSLIINVSDHPKSIYDSLDSYFNEDIVNLEDGPVKKSI
TIAELPQIMQFHVQRVMFDKVKLVAYKSIEPIPFSEKIYLDRYLDTKDEELLRKREQVFQ
WRREILDLTSRISNITQVDERSQMSIIDSLTATKKFLEKRIINNDKLCIELTTIQVISDQ
IEKLKQQLAEAKERIADLQTRISQQFDSYNKIGYSIFAIFIHRGEASYGHYWIYIRDPHQ
HGIFRKYNDEIVSEVPESEVFNFLEGNTATPYYIVYVKDALEKDYINPLNRSITCRS
NT seq 4134 nt NT seq  +upstreamnt  +downstreamnt
atgtacgatgaaattgatctggaaaagcgtctcagtctgcacctggatccaaatttctcc
acaaataatttgaactccaatttggatgatgaacaggctctgtcatcgaattcagagctt
gcaaaaatacaaacacaaatgcaaccaccaacacaggtaggagaacaaacagaaaagcag
aaacaaacagttggactgagtcgtaatccatttaggaacgcctcttctgcgtttgatgag
ctggagaatccaactgaattgctcacctccgaggaaatcgagaaaaccacacaactattt
acacaaccccagtcaggccagtatagtatgcaagaagaggttgcgacaccagccacgatt
tcaacagattttacaatgacgggacccaaattaactccgcaagagctcaaactgtatcct
tttaaaactttaaacagaattttggatgatcttaaatggacggttccctataaggaaaag
tttggccaaagtttattaaacaccagaccaattgagtattcggaaagtttaccagcactt
gttggttcatgccgaactgtacccgaattatgcataatgaatgaaatgattgacttttgt
ccggcaattcaaaagtttgaattctttgacgggaaacaaattgtcaatttaattcgcggt
gtgattatatctaccaataaagaaatatatcactttcgcataatgattttacaggacaac
accaacccattcgttgtgaatgtggttgacaagcaccaataccacgtaattcctgaaagt
catgtatccgatgttgaaaaagagcttttatccacacttcttttggaaagaaatgacacg
gaagagacagcggttattgatgatgcttttttcaaaagtctgagtgcaccgaataacaat
attttacgggtaacaattataaaatccgagttcaatcaggaggatttgaaaagtcttttt
gatccacaggctatcaaggaacggtatttggcaagtttaccacggcatcccgatttggat
gcatcaagaatacccaaagcgcaacaatgtgtcaatatgttgattaaagtattgaaaggg
ccaatcttgttgggagaccaaaacgtcagggtgatcagtctcaacacttctttggatgca
cacgttgatgtgagttttcttattgagaatcttggctttactttggatcgcgaacgaaac
gaagtgagcccgccaaagttgatagactcgcattttttattggagtcatacattcgcaaa
gcacttgagttgatcataattgcacagactttaccacctgagaacaatatagcacgcatc
agctattccttttcaacaaacttgaataaggtgtttgatgtgattgccgaggtggacaaa
aaggagagtacaaccaatttcaccagcaattttgcaaatcgaaacaagtcctttatccaa
ttgagcatatcaggtcattttacagacgatttgattatcaaatgctttgaaagtacaatg
cagtccaatccggagaataaacttttctacattgatgcattaaaggatgtcaagagcatt
agacaatctgcaggtacaagttataattctaaattgacattatacatcaataaaaagttg
catgcaggtgattttgttggatacaaggatttgattgaatcattgaaaattttgggaatc
gaagttgacccttcatacactgacgcgagacttttggacgacgacgctattattgcagcc
tatcaaactcatttcaaggacgaccctagaaattaccaatactacaataagcagcttaaa
agcgttgcaattgccaagaattcacaaagaattcgcgactatttggctggagaaatttta
ccgatgagtttagctttgtttgagcttgaaatcgaagagattaccgaggacgatgttgtc
attactgcatttgaatttaaactagaagatattttacaacgcaatggttttgacaaaacc
gctagtgaagttgtccttcttacgcgtgcatttgcatcaattgctatacaacggaagagc
taccttttattgaactaccttgaacaaaaactaccggaatatgcatcagtgccacaagaa
acaaggtatggtgagactttgctttctcgaagctatgaattgcttggtgctctggatagt
aattctgatttcgagttggtgtctattttccaaagcgtattgtccaccagttcaattgat
atcagggttttacgacgcgcatttaggtcaattgccaactctagaaattcacaagtaatg
caaacgtttttagaaacaggcaagattgactcgcaattgttgcctgcagaaaactggccg
gctggtttggacaatattggaaatacttgttatttaaactcattgctacagtattatttt
tgcatcaagccgttgcgagacttgattttaaactttgatgaagacaagattgatactggg
ctgatttccaatgaaagaaaaattggaggtagagttgttgaagaagcagagattaaacga
gcataccaatttatttatcatttaaaaagtctattccatgaaatgatacatacaaacagt
cgctgcgttaagccaagcagagaattagcatacttgtcgttcttgccctcttcattacct
gtgacttttgtcgatgggaatgagctaggtgcaaagaaatctgaaaatgccgagcaggac
atggatacggaaatggaagatgcagatgtcaccattgttgagcatcaagaatactcaatg
ggaaatacagaatataaagataacctggtcgatgatcataatacagctagttctttgctg
tctaactttgacactgactctttagaagagcctgaaactttggttacaagtggcgagcca
aataaagagtttgatgattttgttgaaggaaaagttgtgaaatttgaaaatgccgatcaa
cctaatgatgatgaagatgaagatgatgttgttgttgagactaaacaaattgaaaacatt
cacaatgatcaatacagggataaagagacaaacaaccttttggatgataggtatgttgac
tcgaggatcctccctatttcagctgatgaaatggagagtacaattgagcttggtcgccaa
caagatgtcacagaatgcattgaaaatgttttgtttcagattgagtctgctttaccacca
acatctttggacgaagataacgagcaaaatgatatggtaaaggagttattttatggaaaa
acaaagcaagtcattcagccattgcaaggagattctttacaaacgagaacatcagttgaa
agattcaacagcttaatcatcaatgttagtgatcatccaaaaagcatatacgattctttg
gacagttactttaatgaagatattgtcaacttggaagatggacccgtcaaaaagtcaatc
accattgctgagcttccccaaattatgcagtttcatgttcaaagagttatgtttgataaa
gtaaagttggttgcgtacaaaagcattgaacccattccatttagtgagaaaatatacctc
gataggtatttggacacaaaagatgaagagttattgcgcaaacgtgaacaagtgtttcaa
tggagaagggagattcttgatttaacaagtcgaatctccaatatcactcaggttgatgag
cgcagtcaaatgtctatcatcgatagcttgactgctacaaagaagttccttgagaaacgt
atcatcaacaatgacaagttgtgcattgagctcacgacaattcaagttatttccgatcaa
attgaaaagttgaagcaacaattggcagaagcaaaggagcgaattgcagatctccaaaca
aggatctctcaacaatttgattcatacaacaagattggatattccatctttgcaattttt
atccatagaggagaagcaagttatggccattactggatttacatcagagatccgcaccaa
catggtatcttcagaaaatataatgacgagattgttagtgaggttcctgaatctgaggta
ttcaatttccttgagggcaacactgcgaccccgtattatatcgtttacgttaaagatgca
ttagaaaaggattacatcaatcctctaaatagatctataacatgtagaagctag

DBGET integrated database retrieval system