KEGG   Lodderomyces elongisporus: LELG_03222Help
Entry
LELG_03222        CDS       T01116                                 

Definition
histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LELG_03222
Transcription machinery [BR:lel03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     LELG_03222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 502 aa AA seqDB search
MVDRKRAFSIRSDDDDDDDDNVPLNKKVKTETPTTETKTKTPIINDDNDVSDLDTEQVKK
THARENNGKPDKLKEITKREKENGDADGNNKNNNNNDNKNNNNNNNEEEDGGEDADDNDD
EVDDDDDDEAEEEKKRITNFNFDGEIYTFKERPSVIEEKEGKIEFRVVNNDNTKESMIVL
TGLKNIFQKQLPKMPREYISRLVYDRSHLSMAVVRKPLTVVGGITYRPFNNRGFAEIVFC
AISSTEQVRGYGAHLMNHLKDYVRATSPIKHFLTYADNYAIGYFKKQGFTKEVTLDKSVW
MGYIKDYEGGTLMQCTMLPLILRYLDLGKILLLQKAAIERKIKLRSKSNVVRPGLQIFKT
NRDAKLDYKDIPGLLEAGWLEEMDNLAQKPKRGPHYNFMVTLFSEMQNHPSAWPFAVPVS
KEEVPDYYEVIKEPMDLSTMELKLENDKYESFDQFLYDARLIFKNCRSYNGDTTTYYKNA
NKLEKFMNNKIKDSAEYSHYLE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggtggaccgtaaaagagcattttcaatcaggtccgatgatgatgatgatgatgacgac
aatgttcctttaaacaaaaaagtaaagactgaaaccccaacaacagaaaccaaaaccaaa
accccaattataaacgacgacaatgatgtttctgatctcgatacagaacaagtaaagaaa
acacatgctagagaaaacaatgggaagccagacaagttgaaggaaataacaaagagagaa
aaagaaaacggcgatgctgatggtaataataaaaataataacaataatgataataaaaat
aataataataataataatgaggaggaggatgggggtgaagatgctgatgacaatgatgat
gaagtagatgacgatgatgacgatgaggcagaggaggaaaagaaacggattactaatttc
aactttgatggagaaatttacacattcaaggaaaggccatcagtgatagaggaaaaagag
ggcaagattgaattccgagtagtcaacaacgacaacaccaaggagagcatgattgtctta
actggtctcaagaatattttccaaaaacaattacccaagatgcctagagagtatatttct
cgactagtttatgacagatcacacctctccatggccgtagtacgaaaaccattgactgtg
gtcggaggaatcacttaccgtccgtttaataatcgaggttttgccgagattgtcttttgc
gcaatctcgtctaccgagcaagtgcgtgggtatggtgctcatttaatgaatcacttaaag
gattatgtacgagcaacttctccaataaaacactttttgacatatgcagataattatgct
atcggatatttcaagaagcaaggctttacaaaagaagtaaccctagacaagtctgtttgg
atggggtatattaaagattatgaaggtggaacattaatgcagtgtacaatgctaccgctg
attttgaggtatcttgacctgggcaagatccttttgttacagaaagctgcaattgaacgc
aaaatcaagctgcgatccaagtccaatgtggtgcgtcctggattgcaaatcttcaaaacc
aatagggatgccaaattggactacaaggatattccaggtttgctagaagccggatggctg
gaggagatggataatttggcacaaaagccaaaacgtggtccacactacaattttatggtt
accttattttcagaaatgcaaaaccatccttcagcttggccctttgccgtacccgttagc
aaagaagaagttccagattactatgaggttatcaaagagcccatggacttgtcaacgatg
gaactgaaattggagaacgacaagtatgagtcgtttgaccagtttctttatgatgcaaga
ctcatattcaagaattgtcgatcatacaacggtgacacgacaacgtattacaagaatgca
aacaagttggagaagtttatgaacaacaagatcaaggatagtgcggagtatagtcattat
ctagaataa

DBGET integrated database retrieval system