KEGG   Lodderomyces elongisporus: LELG_03263Help
Entry
LELG_03263        CDS       T01116                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lel  Lodderomyces elongisporus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LELG_03263
   00052 Galactose metabolism
    LELG_03263
   00500 Starch and sucrose metabolism
    LELG_03263
   00520 Amino sugar and nucleotide sugar metabolism
    LELG_03263
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LELG_03263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 493 aa AA seqDB search
MSTKRHTKSQSAYAFDNTATNVAASQMRNALNNLADTVKDPEEKHRFENEMDNFFSLFRR
YLTEKASGTTLEWDKIRSPSADEVVGYKDLDDATPDLTKLAVLKLNGGLGTSMGCVGPKS
VIEVRDGNTFLDLSVRQIEHLNRKYDADVPLLLMNSFNTDADTAKIIRKYQGHRIRVKTF
NQSKFPRIYKDSLLPVPESSDDPLEGWYPPGHGDLFEALVQSGELDALLAQGREILFVSN
GDNLGATVDTKILAHMLETGAEYIMELTDKTRADVKGGTLINYQGEVRLLEIAQVPKEHV
EEFKSIKKFKYFNTNNLWINLRAIKRLVEANAIEAEIIPNQKTIGNDINVLQLETAVGAA
IRHFKGAHGVVVPRSRFLPVKTCSDLLLVKSDLFFLEHGALKLDPTREGFANPLIKLGSH
FKKVSGFQARIPHMPKILELDHLTITGNVSIGKGVQLKGTVIIVCNDGDKIDIPNGSILE
NVVVTGNLTLLEH
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaaagagacacactaaaagtcaatcagcttacgcctttgacaacaccgctact
aatgtcgcggcttcacagatgcgtaatgcattgaacaacttggcagatacagtcaaggac
cctgaggagaaacacaggtttgaaaatgaaatggacaactttttttcattgtttagaaga
tacttgactgaaaaggcttccggaaccactttggaatgggacaagatcagatcaccatct
gcagacgaagtcgttggttacaaggacttggacgacgcaactccagacttgaccaagttg
gcggtcttgaaattgaacggtggtttgggtacctctatgggatgtgttggtcccaaatcg
gttattgaagttagagacggtaacacattcttggacctttcagttagacagattgagcat
ttgaacagaaagtacgacgctgacgtgccattattgttgatgaactcatttaatactgat
gctgatactgccaagattattcgaaaataccagggccacagaataagagtcaagactttt
aaccaatccaaattcccaagaatctacaaagactctttgttaccagttcctgaatcttca
gacgatcccctcgaaggctggtaccctccaggtcacggtgatttgtttgaagccttggtc
caatccggcgaacttgacgcgttgttggcacaaggaagagaaattttgtttgtttccaat
ggtgacaacttgggtgcaaccgttgataccaagatcttggctcacatgttggaaaccggc
gcagagtatatcatggaattgactgacaagaccagagcagatgtcaagggtggtactttg
atcaactaccaaggcgaggtgagattattggagattgcccaggttccaaaagaacacgtt
gaagagttcaagagtattaagaaattcaaatacttcaacaccaacaacttgtggatcaac
ttgagagccattaaacgtttggtagaggccaatgctatcgaagcggaaatcatcccaaat
caaaagactattggcaatgatatcaatgtcttgcaattggagacggcagttggagcagct
attagacatttcaaaggtgcacacggtgtcgttgtgcccaggtccagattcctccctgtc
aagacatgttccgatttgcttcttgtcaaatcagacttgttctttttggaacacggtgca
ttgaaacttgatcctactagagaaggttttgccaacccattgatcaaattgggatctcat
ttcaaaaaggtgagcggattccaagccagaatcccacacatgcccaagatcttggaattg
gaccacttgaccattacaggaaatgtcagtattggtaaaggcgttcaattgaagggtact
gttatcattgtctgtaatgatggcgataagattgacattccaaatggatcaatcttggaa
aacgttgttgttaccggtaacttgaccttgttggagcattaa

DBGET integrated database retrieval system