KEGG   Lodderomyces elongisporus: LELG_03266Help
Entry
LELG_03266        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
lel  Lodderomyces elongisporus
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    LELG_03266
  Amino acid metabolism
   00380 Tryptophan metabolism
    LELG_03266
Enzymes [BR:lel01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     LELG_03266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 491 aa AA seqDB search
MIVLFITILLVLSALIVFPPLNFPRNIPTIPFYVSFLGGMDQLEKFEKYLRTKLEKHGAV
KIYFASRWNILVTKPEYLVHIFKNEDVFAKSGNHIKIPGSVLATYTGDNIISAHGQLWRL
YRDVMAQSIQFPNLDPIAENTNNLMKDLENALKFDSSVAITDFLQQYSLANVGDCIVGSN
LRPMHQKIKYIKLQIFKPFYMNFPSVEMLPIPSRIRAKQEVENFRQWFGDKLMDADHGAA
VKLATAYNEGKLTQKQYLDNCIILMVAGHENPLLLMLSLLYVLAKNPYMQDKIRCNKEIE
EHGKEEGGRVVEEEGEEGEEEEGEEEEEEEEEEEEEEEEKSPELYLSAVIYETLRMYPPL
NQIINRCTTKDTMLGNIRIPKGTYVGYYNMGTGRDKTVWESPDTFWPERWGNTIEEVHAN
YTRAKRLGHLPAFHGRKRACLGEKFALYQCKAMVQAILGKYKISLDEDWEERITPAGPVC
PMNMKLRFSKI
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgattgtcttatttattacaattttattggtcttgtctgcactgattgttttcccacca
ttgaacttcccaagaaacattcctacaataccattctatgtatcgtttcttggagggatg
gatcaacttgaaaagtttgaaaaatacttgcgcacgaagttagagaaacatggtgcagta
aagatatattttgcttctagatggaacattcttgttaccaaaccagaatacttggttcac
atcttcaagaacgaagatgtatttgccaagagtgggaaccacattaagataccaggctcc
gttttggcaacttacacaggagataatatcatttctgctcatggccaattatggagacta
taccgagatgtgatggcacagagtattcagtttccaaatttggacccgatagctgagaat
accaataacttgatgaaagatcttgagaatgccttgaaatttgattcgtcagtggcaatt
acagacttcctacaacaatactcattagcaaatgttggtgattgtattgttggctcaaat
ttacgaccaatgcatcaaaagatcaaatatatcaaactgcaaattttcaaacctttttac
atgaattttccttcggttgagatgttgcctatccctagccgcataagggccaagcaagaa
gttgaaaattttcgtcaatggtttggagacaagttgatggatgcagatcatggagcagct
gtcaagttagccacagcttataatgaggggaagttgacgcaaaaacagtatttagataac
tgcatcattttgatggttgcaggacacgagaatccacttttgcttatgctttccttgttg
tatgttttggctaagaatccttatatgcaggacaagattcgctgcaacaaagaaatagaa
gaacatggcaaagaagaagggggaagagtagtagaagaagaaggagaagaaggagaagaa
gaagaaggagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaaaaa
tcacctgagctatacttgtccgcagtaatttatgaaacattaaggatgtatcctcctttg
aatcaaattattaatcggtgcactactaaagataccatgttgggaaatatacgaattcct
aaaggaacatatgttggctattataatatgggaactggaagagataagaccgtttgggaa
tctccagacacgttttggcccgagagatggggtaatacaattgaggaagttcatgccaac
tacacaagggctaaaagattagggcatctacctgcattccatggcaggaaaagagcttgc
ttaggtgagaaatttgctttgtatcagtgtaaggcaatggtgcaagctattttaggaaag
tacaagatttccttggatgaggattgggaggaaagaataacaccggccggacctgtgtgt
ccaatgaatatgaagttgagatttagtaaaatctag

DBGET integrated database retrieval system