KEGG   Lodderomyces elongisporus: LELG_03279Help
Entry
LELG_03279        CDS       T01116                                 

Definition
TFIIH basal transcription factor complex subunit 2
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
lel  Lodderomyces elongisporus
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:lel00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    LELG_03279
  Replication and repair
   03420 Nucleotide excision repair
    LELG_03279
Transcription machinery [BR:lel03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     LELG_03279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 503 aa AA seqDB search
MSSNLFKATVNEYLEDLPKAVQLKLYEAPATCLAIYRLLSSMAKFYIMSMIFTEKPVSMK
DLTKWCKPLAKKLEFDALKRLESLHLIEFDSKGTHLRLNTIFRTNFRDCLTGSQDPNAFG
SVSTTADPNKVDLAFLDSFASQKWESILHFMVGTEGTKPPSKSVLSLLKLGGLMEQHEED
GTLNITNTGFQFLLQDVNAQIWTLLLQYLNLTQELNMDAVDVLNFIFILGSLELGNSYSV
SNLSETQVSMLADLKDYGLVYQKSDTSSRFYPTRLATTLTSDSAALKTPSMAVEQALDET
ETSLASSTQTKESIIIETNFKMYAYTNSPLEIAILNLFVHMKTRFSNMICGQITRESIRN
ALYNGITADQIIKFLETHAHPQMRALAKERLDKKVEFDASHNINTAGGAPQSKTDGAISQ
HRLEVLPPNVVDQIKLWQLELDRIQTFDGYLFKDFANQQEYDMLSNYAAEIGVLIWADKV
KKKFFVTKDGMTQVAEFANRKLR
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcaaatctttttaaagcaactgtcaatgagtatttagaagatctaccgaaagct
gttcaacttaagctttatgaagcaccagccacgtgtcttgccatttatagacttctttct
tcaatggcaaaattctacatcatgtcgatgatattcaccgaaaagcctgtgtccatgaag
gacttgactaaatggtgcaaacctctggcgaaaaagcttgagtttgatgcgttaaaacga
ctagagtctcttcatctcatcgagtttgatagcaagggaacgcaccttcgactaaacacc
atattccgcaccaatttcagagactgcttgacaggttctcaggatccgaatgcatttgga
agtgtgagcactacagcggatcctaataaggtggacttggcctttcttgactcgtttgct
tctcaaaaatgggagagtattttgcattttatggtgggaacagagggaacaaaaccacct
tcaaaatcagtgttgagcttattgaaacttgggggtttaatggagcaacatgaagaggat
ggcactctcaacattaccaatactggctttcagtttcttttgcaagatgtcaatgcgcag
atatggacattattgttgcagtacttgaaccttactcaggaactcaacatggatgcagtg
gatgtgctaaatttcatatttattcttggttcattggagttgggaaacagttactctgtt
tcgaatttaagtgaaacccaggtgagcatgcttgctgatttgaaagactacgggctagtt
tatcagaaaagcgacacctcaagtcgattttatccaactagacttgctacaaccttgact
tcggactcagcagcattgaaaactccctcaatggcagtggagcaggctttggatgagacg
gagacttcgttggcgtcatcgacgcagacgaaagagtctatcattattgaaacaaacttt
aaaatgtatgcctataccaattcaccattggaaattgctatattgaatttgtttgtgcac
atgaagaccagattttcaaatatgatttgtggtcaaataacccgtgaatcgattcgaaat
gcgctatacaatggtattacggcagaccaaatcattaaattcttggagacgcatgcgcac
ccacaaatgagagcattggccaaggagaggttggataagaaagtcgaattcgatgctagt
cataatattaatacggcaggtggtgcacctcaaagtaaaaccgatggtgcaatttcgcaa
cacagattggaagtgctcccaccaaacgttgtagaccaaataaaattatggcagcttgaa
ttggaccggatccaaacttttgacgggtacttgttcaaagattttgccaatcagcaggag
tatgatatgttgtccaattatgcagcagaaattggagtgcttatatgggcagataaagta
aagaaaaagtttttcgttacgaaagatgggatgacacaagttgccgaatttgctaataga
aaacttaggtag

DBGET integrated database retrieval system