KEGG   Lodderomyces elongisporus: LELG_03296Help
Entry
LELG_03296        CDS       T01116                                 

Definition
similar to dihydrolipoamide S-succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lel  Lodderomyces elongisporus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LELG_03296
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LELG_03296
  Amino acid metabolism
   00310 Lysine degradation
    LELG_03296
Enzymes [BR:lel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LELG_03296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 466 aa AA seqDB search
MLSRSVSSSIKRSAKTTTLKARAVTTLKTANASPSLTRSLYTSINNNNQSSSLKANTTIT
TKTNAFNTPFTFQRFASTKVKVPDMAESITEGTLAAFTKEVGDFVKQDETIATIETDKID
VEVNSPVSGTIKSFLVDVEATVEVGQEIAEIEEGDAPAAGNEGAEKAKPEESSKKDEGKE
ESKPEPKKQDAEKSKPQPFKKEESSSKPASSSSSKKDTSAKESSSTPSFTNFSRNEERVK
MNRMRLRIAERLKESQNTAASLTTFNEVDMSNLMEMRKLYKDEFLDKPGIKLGFMGAFSK
AACLAAKDIPADNASIENNDTLVFRDYTDISIAVCYTKRFGHPNCEKRRVKIHLGHEQEI
ANLGKKARDGKLTLEDMTGGTFTISNGGVFGSLYGTPIINMPQTAVLGLLGVKERPVTVN
GQIVSRPMMYLALTYDHRVLDGREAVTFLKTIKELIEDPRKMLLLE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgttatccagaagtgtaagttcatcgattaagcgtagtgctaaaactaccacattaaag
gctagagcagtaacgactttgaagactgccaatgcttcgccatcattgaccagatcactt
tacacatccattaacaataacaaccaatcttcaagtttaaaagccaacaccaccattact
actaaaaccaatgctttcaatactccattcacattccaaagatttgcatcaaccaaggtg
aaggtgccggatatggcggagtctatcactgaaggtactttggctgctttcacaaaggaa
gttggcgactttgtaaaacaagatgaaacaattgccaccatcgaaacagacaaaatcgat
gtcgaagtcaactcaccagtctctggtaccatcaagagcttcttggttgacgttgaagct
accgttgaagttggccaagaaattgctgaaattgaagaaggtgacgcaccagctgccggt
aatgaaggcgccgaaaaggcaaaaccagaagaatcttcaaagaaggatgaaggaaaggag
gaaagcaaaccagagccaaagaagcaagatgctgaaaagagcaaacctcaaccttttaaa
aaggaagagtccagcagcaaaccagcctcttcttcctcttcaaagaaggacacttcagct
aaagagtcatcttcaacaccatcattcaccaacttttccagaaacgaagaaagagtcaag
atgaacagaatgagattgagaattgccgagcgtcttaaggaatctcaaaacactgctgcc
tcattaaccacattcaacgaggttgacatgtccaacttgatggagatgagaaaattatac
aaggacgaattcctcgacaagcccggtataaagttgggattcatgggtgctttctccaag
gctgcctgcttagctgccaaagatattcccgctgataacgcatcaatcgaaaacaacgac
acattggtgtttagagactacactgatatttcaattgctgtttgctacaccaaaaggttt
ggtcaccccaattgtgagaaacgccgagtcaagatccatcttgggcatgaacaagaaatt
gccaacttgggtaaaaaggcccgtgacggtaagttgaccttggaagacatgactggtggt
acattcaccatctccaacggaggtgtgtttggttccctttacggtacaccaatcatcaac
atgccacaaaccgctgtgttgggattgctcggtgtcaaagaaagaccagtcactgttaac
ggacaaattgtttcaagaccaatgatgtacttggccttgacttatgaccacagagtcttg
gatggtagagaagccgtgactttcttaaagacaattaaggaattgattgaagacccaaga
aagatgttgcttttggaataa

DBGET integrated database retrieval system