KEGG   Lodderomyces elongisporus: LELG_03296Help
Entry
LELG_03296        CDS       T01116                                 

Definition
(RefSeq) similar to dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00020  Citrate cycle (TCA cycle)
lel00310  Lysine degradation
lel01100  Metabolic pathways
lel01110  Biosynthesis of secondary metabolites
lel01130  Biosynthesis of antibiotics
lel01200  Carbon metabolism
Module
lel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lel_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LELG_03296
  Amino acid metabolism
   00310 Lysine degradation
    LELG_03296
Enzymes [BR:lel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LELG_03296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3
Motif
Other DBs
NCBI-GeneID: 5232805
NCBI-ProteinID: XP_001525368
UniProt: A5E109
AA seq 466 aa AA seqDB search
MLSRSVSSSIKRSAKTTTLKARAVTTLKTANASPSLTRSLYTSINNNNQSSSLKANTTIT
TKTNAFNTPFTFQRFASTKVKVPDMAESITEGTLAAFTKEVGDFVKQDETIATIETDKID
VEVNSPVSGTIKSFLVDVEATVEVGQEIAEIEEGDAPAAGNEGAEKAKPEESSKKDEGKE
ESKPEPKKQDAEKSKPQPFKKEESSSKPASSSSSKKDTSAKESSSTPSFTNFSRNEERVK
MNRMRLRIAERLKESQNTAASLTTFNEVDMSNLMEMRKLYKDEFLDKPGIKLGFMGAFSK
AACLAAKDIPADNASIENNDTLVFRDYTDISIAVCYTKRFGHPNCEKRRVKIHLGHEQEI
ANLGKKARDGKLTLEDMTGGTFTISNGGVFGSLYGTPIINMPQTAVLGLLGVKERPVTVN
GQIVSRPMMYLALTYDHRVLDGREAVTFLKTIKELIEDPRKMLLLE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgttatccagaagtgtaagttcatcgattaagcgtagtgctaaaactaccacattaaag
gctagagcagtaacgactttgaagactgccaatgcttcgccatcattgaccagatcactt
tacacatccattaacaataacaaccaatcttcaagtttaaaagccaacaccaccattact
actaaaaccaatgctttcaatactccattcacattccaaagatttgcatcaaccaaggtg
aaggtgccggatatggcggagtctatcactgaaggtactttggctgctttcacaaaggaa
gttggcgactttgtaaaacaagatgaaacaattgccaccatcgaaacagacaaaatcgat
gtcgaagtcaactcaccagtctctggtaccatcaagagcttcttggttgacgttgaagct
accgttgaagttggccaagaaattgctgaaattgaagaaggtgacgcaccagctgccggt
aatgaaggcgccgaaaaggcaaaaccagaagaatcttcaaagaaggatgaaggaaaggag
gaaagcaaaccagagccaaagaagcaagatgctgaaaagagcaaacctcaaccttttaaa
aaggaagagtccagcagcaaaccagcctcttcttcctcttcaaagaaggacacttcagct
aaagagtcatcttcaacaccatcattcaccaacttttccagaaacgaagaaagagtcaag
atgaacagaatgagattgagaattgccgagcgtcttaaggaatctcaaaacactgctgcc
tcattaaccacattcaacgaggttgacatgtccaacttgatggagatgagaaaattatac
aaggacgaattcctcgacaagcccggtataaagttgggattcatgggtgctttctccaag
gctgcctgcttagctgccaaagatattcccgctgataacgcatcaatcgaaaacaacgac
acattggtgtttagagactacactgatatttcaattgctgtttgctacaccaaaaggttt
ggtcaccccaattgtgagaaacgccgagtcaagatccatcttgggcatgaacaagaaatt
gccaacttgggtaaaaaggcccgtgacggtaagttgaccttggaagacatgactggtggt
acattcaccatctccaacggaggtgtgtttggttccctttacggtacaccaatcatcaac
atgccacaaaccgctgtgttgggattgctcggtgtcaaagaaagaccagtcactgttaac
ggacaaattgtttcaagaccaatgatgtacttggccttgacttatgaccacagagtcttg
gatggtagagaagccgtgactttcttaaagacaattaaggaattgattgaagacccaaga
aagatgttgcttttggaataa

DBGET integrated database retrieval system