KEGG   Lodderomyces elongisporus: LELG_03420Help
Entry
LELG_03420        CDS       T01116                                 

Definition
similar to protein kinase afc2
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     LELG_03420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 498 aa AA seqDB search
MSLLSNRKRPRGYSSENFANAKANGMTNSSSTLYQEPDHHQQLLQFQYSQQQHQLHQHQQ
QQHVQNGLQQDGQRYFGNQEADLLIYQSTYQPNSLYFPTLHDDSSSTIIEEDPNSDVLGP
IPTYSTNLQSKKSKFNNPFLSVEEHELLIGGEGNNNANNININNDDDDDDVVVDEGDGIE
EANTFVLDDDDEGRNIYDEDDDVIIIEEKDLVQKGNRNNSDSILINLDAAAAYKLFNVNA
VDSNENDSNTSNSTFFTTKMAKKKQRTSSLPQLPQVKCFYNKLPNNYILQTPKLGNIKTN
VIPFQNNLPPCDDENGHYIIKINDNFANRFVILKLLGQGTFGKVVECYDKVNREHVAIKI
IRNIQKYRDAAKIELRILSTLKKFDNANKNHCIHLRECFDYRGHICIVTDLLKISLYDFL
ENNRFIPFPGSHIQAVSKQLIRSVTFLHDLNLIHTDLKPENILLHDDSFVKKALYSSTTV
TAYTKIGVSNANTASSTL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgttaagcaatagaaaaagacctagaggctatagcagtgagaactttgccaac
gccaaagcaaatggcatgaccaatagtagttcgacattgtaccaagagccagatcatcac
caacaattgctgcaattccaatactcgcaacagcaacaccagctgcaccagcatcaacaa
cagcaacacgttcagaatggactgcaacaggatggtcaaagatattttggtaaccaagaa
gctgatctgctgatctaccagtcaacttaccaaccaaacagcctgtatttcccaaccttg
cacgacgattcatcgtcaaccattattgaagaagaccctaactcagatgtcttgggtccc
atcccaacatactcaaccaacttgcaatcaaagaaatcgaaattcaacaacccattctta
tcggttgaagaacacgagttactcattggcggtgaaggtaataacaatgctaataatatc
aatatcaacaatgatgatgatgatgatgatgtagttgttgacgaaggtgatggtattgaa
gaggcaaatacttttgtattggacgacgatgacgaaggccgcaatatatacgatgaagac
gacgatgtcattatcattgaagaaaaagatttggtgcaaaagggcaacaggaataatagc
gactcgatcttgatcaacctggatgcagcagctgcatacaaattgtttaatgtcaatgca
gtagactctaatgaaaacgacagcaacacttccaatagcacattcttcaccacaaaaatg
gcaaaaaagaaacaaagaactagctcattaccgcaattgccacaggtcaaatgtttctac
aacaaattaccaaacaattatattttgcaaacacccaaattgggcaatatcaagaccaat
gtgattccattccagaataacttgccaccatgcgacgatgaaaatggacactacatcata
aagattaatgacaattttgccaatagatttgtaatccttaaactattgggccaaggaaca
tttggcaaagttgtagagtgctacgacaaagtcaatagagagcacgttgccatcaagatt
attagaaacattcagaagtaccgcgatgccgccaagattgagttgcgaatactttcgaca
ttaaagaaattcgacaatgctaataaaaaccactgtatccatcttcgagaatgttttgac
tatagaggccacatttgcattgtaactgatttgctaaaaatttcactttatgatttcttg
gaaaacaacaggtttattccattcccaggaagtcatattcaagcagtctcaaagcaactt
atacgatcagtgacttttctacatgacctaaacttgatccacacggatttaaaaccagaa
aatatcctactccatgacgactcgtttgtcaaaaaggcactttacagctctacgacggtg
acagcatatacaaagattggcgttagcaacgctaataccgcctccagcacattataa

DBGET integrated database retrieval system