KEGG   Lodderomyces elongisporus: LELG_03461Help
Entry
LELG_03461        CDS       T01116                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lel  Lodderomyces elongisporus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LELG_03461
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LELG_03461
Exosome [BR:lel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LELG_03461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 631 aa AA seqDB search
MPRRNSNFPSIPLVATIDIGTTSARAILFSDKGQEIAKHQIEYSTTASEAPEHSQNTDQF
RRRSSLLRHDEPIFSAEGIAISIEDNVEIENNRSSVGPTLRFPQPGWVECMPVHILANAV
QCLVACLITLRKINQNPNLKVKYKVKCIGIANMRETTIVWSRRTGKPLSGGITWTDVRTA
EIVQHLEKMIDEDRKAELREKTGLPLSTYFSAAKLRWLLDNDDTIRDKYERSDGDLMFGT
VDTWLIYHLTKEKTFVSDITNASRTYFMDLETQDYDDDLLDFWGIDPTKIMLPKIVSSSE
FYGSFAAPNLSNLGFHNKITQEAYDILKTITGVPICGCLGDQSASLVGQLAFNPGSAKCT
YGTGCFLLYNTGSRKLISKHGALTTFGYWFPTQDGDKGKPHYALEGSIAVAGSIIQWLRD
NLKMIENAKDIGPLASQVDNSGGVVFIPAFSGLYAPYWDRGARGTIFGMTQYTSASHIAR
AALEGVCFQVRAILKAMANDAGSSGDFLEEALSSQSESKPLLHLATDGGMSKADEVLQIQ
ADILGPCVEVKRAQISECTALGAAIAAGLSFKDPEERIWRDLEDVVDKIEEKDEVLSNTF
KAQLPDADRRKNWKRWERAIERAQGWLQDED
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgccgagaagaaatagcaattttccatctataccattggtggccactattgacattggt
acaacttctgcccgtgccatacttttctcagataaaggtcaagaaattgccaagcatcaa
attgagtattccaccacagcatcagaggctcctgaacactcgcaaaacactgatcaattc
agaagaaggtcctcgcttttgagacacgacgagccgatcttctctgcagagggtattgcc
atttcgattgaagataatgttgaaattgagaataacagatcctcggtcggaccaacgttg
cggttcccacagcctggttgggttgagtgtatgccagtgcacatcttagctaacgctgtg
caatgtcttgttgcttgtttgatcaccttgaggaaaatcaaccaaaaccccaatttgaag
gttaagtacaaggtcaagtgtattggaattgccaacatgagagaaaccactattgtttgg
tcaagacgtactggtaagccattgagtggcggtatcacgtggacagatgtgagaacagca
gagattgttcaacatttggagaagatgattgatgaggacaggaaagccgagttgagagaa
aagactgggttaccattgtccacatatttctcggcggccaaattaagatggttattggat
aatgatgacactataagagacaaatatgagagaagcgatggtgatctcatgtttggaaca
gttgatacctggttaatctaccacttgacaaaggaaaagacatttgtgtcagatatcacc
aatgcgtcaagaacatatttcatggatttggagactcaagactatgacgatgatcttttg
gatttttggggaatcgatccaacaaagattatgttacccaagattgtctcgtcctctgag
ttttacgggtcatttgccgcaccaaatttgtccaatttgggattccacaataagattacc
caagaggcttacgatattcttaaaacaattactggtgttcccatttgtggatgtttgggt
gaccaaagtgcctctttggttggtcagttggcttttaatcctggctcagctaaatgtaca
tatggtacaggttgtttccttttgtacaacacaggtagtcgtaagttgataagtaaacat
ggtgcgttaacgacttttggttattggttccccacacaagatggcgacaagggtaagcca
cattacgctttggaaggttctattgctgttgctgggtcgattattcaatggttgagagac
aatttaaaaatgattgagaatgccaaagatattggtcctcttgcttcacaagttgacaat
tcgggcggtgttgtattcattccagcattcagtggtctttacgcaccttactgggatcgt
ggcgccagaggtaccatttttggaatgactcaatacacttcggcatcccacattgctaga
gccgcattggaaggtgtttgtttccaagtgcgtgctattttaaaggctatggctaatgac
gctggatcatcgggcgatttccttgaggaggctctcagctcacagtctgaaagtaaacca
ttgctgcatttggctactgatggtggtatgtctaaagcagatgaagttttgcaaatccaa
gcagacatcttgggtccgtgtgtcgaggtgaagagagcccaaatttcagagtgtacggca
ttgggtgctgcaattgctgcgggcttatcgttcaaagatcctgaggagcgtatatggaga
gatttggaggatgtggttgacaagattgaggagaaggatgaagtgctttcaaacacattt
aaagcacagctacccgatgctgataggaggaaaaactggaagagatgggagagggccatt
gagagagcacaaggatggttacaagatgaagattaa

DBGET integrated database retrieval system