KEGG   Lodderomyces elongisporus: LELG_03572Help
Entry
LELG_03572        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lel  Lodderomyces elongisporus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LELG_03572
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LELG_03572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 161 aa AA seqDB search
MSKTVTIIGSLNYDLVTFTKKVPKAGETIQANSFETHMGGKGLNEAVAVARLSPLLGHVQ
SRMIGCVGADDFGKSLKQCLVDSGVDVSNVKTIEGESSGVATILVEEESGENRILITAGA
NGHLKPSDEEYKSIFELDKEDKNEYVVLQNEYPDTERVFRG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaacagttactatcattggatcattgaactatgatttagtcacattcacaaaa
aaagtacctaaagcaggtgagacgatccaagcaaactcatttgaaacacacatgggaggc
aaaggattgaacgaggctgttgcggttgcgagattatcgcctcttctgggccacgtgcaa
tcccgtatgattggttgcgttggagctgatgattttggaaaaagtctcaagcagtgtctt
gttgactctggtgtagatgtatccaatgtcaagacgattgaaggtgaatcatctggtgta
gcaactatccttgttgaggaggagtcaggggagaataggatattgattactgcgggagcc
aatggacacttgaaacctagtgatgaagaatacaagtccatctttgaactggataaagag
gataagaatgaatatgttgttttgcagaatgagtaccctgatactgaaagagtatttcgt
ggctaa

DBGET integrated database retrieval system