KEGG   Lodderomyces elongisporus: LELG_03656Help
Entry
LELG_03656        CDS       T01116                                 

Definition
sporulation-specific mitogen-activated protein kinase SMK1
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LELG_03656
Protein kinases [BR:lel01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LELG_03656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 245 aa AA seqDB search
MYQILCGLKYIHSADVIHRDLKPGNILVTTQGTLKICDFGLARGINPNFFKKNKATGGIG
NGTGMGTGVDTVAITNYVATRWYRAPELILSTKNYTKSVDIWAIGCILGELFGRRPMFPG
KSLQEQILELIKILGSPPNDTVKRYNWNIEGVSWVRFKSVKWTSLYPFAPKEAMNLLSQL
LQWDYKKRLEVEEVLEHEFFKYVRNPVDEPSSETLFDFSFEEMANDINSLKEVLEREVKE
FVCST
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaaatcttgtgtgggttgaaatatatacattctgccgatgtcattcatcgtgat
ctcaagccgggaaacattttggttactacacagggtactttaaagatatgcgactttggc
cttgcgcgtggtataaacccaaactttttcaaaaagaacaaagctactggaggtattgga
aatggcactggtatgggaacaggtgtcgatacagtagcgattacaaattatgttgcgaca
agatggtaccgtgcaccagagttgattctttcaactaagaattataccaaaagtgttgat
atttgggctataggatgtatattgggtgaactatttggtagaagaccaatgtttccgggc
aagagtctgcaggaacaaatactggagttgatcaagattttgggcagcccaccaaacgat
acggtcaagaggtacaattggaacatagaaggcgtgtcttgggttagattcaagtctgtg
aaatggactagtctttacccgtttgcacccaaggaggctatgaatttgttatcacagttg
ttgcaatgggactacaaaaagaggttggaagttgaggaggttttagagcatgagtttttc
aagtatgtgcggaacccagtcgatgagccaagtagtgagactttgtttgatttcagcttt
gaagaaatggcaaatgatatcaatagtttaaaggaggtgttggagagagaagtgaaggaa
tttgtgtgtagcacctaa

DBGET integrated database retrieval system