KEGG   Lodderomyces elongisporus: LELG_03681Help
Entry
LELG_03681        CDS       T01116                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lel  Lodderomyces elongisporus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LELG_03681
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LELG_03681
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LELG_03681
Enzymes [BR:lel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LELG_03681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 504 aa AA seqDB search
MSSQVYRSTRSSQPEELSFEDVVMTGLAPDGGLYLPSSIPQLPSNFTETWKDLSFNELAF
EILRLYINELEIPSDDLKDLIKRSYATFRSDEVTPIKKLDDNLHILELFHGPTYAFKDVA
LQFVGNLFEYFLVRCNNKKKEGEPRDIITVVGATSGDTGSAAIYGLRGKKDVSVFILYPT
GRISPIQEEQMTTVEDANVHTLSVNGTFDDCQDIVKSIFGDKEFNDKYHVGAVNSINWAR
ILAQQTYYFYSYFQLQKQLGGNSKVRFVVPSGNFGDILAGYYAYKMGLPVDKLIIATNEN
DILDRFMKSGEYAKQQEVGVKVTYSPAMDILISSNFERLLWYLIRDNVANGNDEKAGEIL
SGWMKELKENGKFTAPQEVVEKARVVFDSDRVSNEDTIKTIKEVYSNNPEKYIIDPHTAI
GVKTSYRFIEKEPKAEYISLSTAHPAKFSEVVNKALESFDGYSFEKDVLPAELKALSTKE
KRIKLIDEPSIEKVKQAIKDELKF
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcacaagtttatagatccaccaggtccagccagccagaggaactctcctttgag
gatgtggtcatgaccgggttggcccccgatggaggtctttatttgccctcttcaatccca
caattaccatccaacttcactgaaacttggaaagacttgtcattcaacgagttggccttc
gagattttaagattgtacatcaacgaactggagatcccaagcgacgacttaaaggacttg
atcaagagatcgtatgctacattcagatctgatgaagttacaccaattaagaaattggac
gacaatttacacattttggagttattccatggtccaacatatgcctttaaggatgttgca
cttcaatttgtgggaaacttgtttgagtatttcttggtgagatgcaacaacaagaagaag
gaaggtgagccaagagacatcattaccgttgttggtgccacctctggagatactggttct
gctgccatttacggattgagaggtaagaaggatgtttctgtgttcatcttgtaccccact
ggaagaattagtcctattcaagaagagcaaatgactacagttgaagacgccaatgtacac
accctttccgttaatggtacttttgacgattgccaagatattgtcaaatcaatctttggt
gacaaggagttcaacgacaaataccatgttggtgcagtcaactccatcaactgggcaaga
atcttggcacaacagacttactacttctactcctacttccaattgcaaaaacaactcggt
ggaaactcaaaagtcagattcgttgttccatcaggtaactttggagacattttggcaggt
tactatgcatacaagatgggattgccagtggacaaattgattattgccacaaatgaaaac
gatatccttgacagatttatgaaatctggagaatatgcaaagcagcaagaagtcggtgtc
aaggtcacctactcgccagccatggacattttgatctcgtccaattttgaaagattgttg
tggtacttgatcagagacaatgttgccaacggcaatgacgagaaagccggcgagatcttg
agcggatggatgaaagagttgaaggaaaacggtaaatttacagcacctcaagaagttgtt
gaaaaagccagagttgttttcgactccgatagagtcagcaacgaggacaccatcaagacc
atcaaggaagtgtattcaaacaacccagaaaagtacatcattgacccacacacagcaatt
ggagtcaagacatcctacagattcatcgaaaaagaacctaaagcagaatacatctcgctc
tcgactgcccatccagccaagttctccgaggttgtcaacaaggcactcgagtcgtttgac
ggttactcttttgagaaggatgtacttccagcagagcttaaggctttgagcaccaaggaa
aagagaatcaagctcattgacgagccaagcatcgaaaaggtgaaacaggccatcaaagat
gagttgaagttttaa

DBGET integrated database retrieval system