KEGG   Lodderomyces elongisporus: LELG_03683Help
Entry
LELG_03683        CDS       T01116                                 

Definition
beta-hexosaminidase precursor
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
lel  Lodderomyces elongisporus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LELG_03683
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    LELG_03683
   00603 Glycosphingolipid biosynthesis - globo series
    LELG_03683
   00604 Glycosphingolipid biosynthesis - ganglio series
    LELG_03683
   00511 Other glycan degradation
    LELG_03683
Enzymes [BR:lel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LELG_03683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 560 aa AA seqDB search
MWNIILVYFYTIAVVASVLVDPLPRPQSINWLGNTSITIDINQLQLNTNSSILNDAFSRT
IAQVRRAKWSPYDYTNSTDPIIVVSSTLESHVIDIQVDDLDQDLQVGVDESFELQVNETQ
IGISSGTIWGALHALTTLAQLLVYKGNNGHWICESSVHIEDYPQYQHRGLMIDSARNFLP
VANVLEQIEIMSLCKMNVLHWHLVDSQSWPLLLESHPEMIRDAYSLGEIYTKDELKLVQD
FARSRGVRVIPEIDMPGHARAGWRQIDPNIVLCGNDWWGDVAVEPPPGQLNIMDLDTYKY
ISDVYNELSNVFGDKYFHVGNDELQKNCFPREWFNNATTLGDVVQHYIDRALPLFNAIPG
RKLMMWDDVLLSSDGAAHSLPSNVTLQVWHEQSGVKNLTLQGYEVVVSLSSHLYLDCGYG
GWVTDDFRYVDSPENEEFNNGQGGSWCAPYKTWQRIYTFDIAQNLTREESKLVLGAEAVL
FSEQVDFTVLTGKIWPRTSALAESLWSGNKNAEGVFRLEEMTTRILLFREFLIKAGHPAA
PLVPKYCVMNPHACDLNKPK
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacatcatacttgtctacttttacaccattgccgtggttgcgtcagtgcttgtt
gatccattaccgcgtcctcaaagtatcaattggttaggcaatacgtccataacaatcgat
attaatcaattgcaactaaataccaatagttcaatccttaatgacgctttcagcagaaca
attgcacaagtgagacgtgccaaatggtcgccttatgactatactaattcaacggatcca
attattgttgtttccagcaccttggagtcacatgtgattgatatacaagtggatgatctc
gaccaagatttacaagtgggagtcgatgagtcctttgaattgcaggtaaacgaaacccag
attggaatatcgagtggcacaatctggggtgcgttgcatgcattaacgactttggcgcaa
cttttggtgtacaaaggcaacaatggtcactggatatgtgagtcgtcagtacatatcgag
gattacccacaatatcaacatagggggctcatgattgattccgccaggaatttcttgcca
gtggcaaatgtcttggaacaaatagagattatgtcgttgtgcaaaatgaatgtactccat
tggcatttggttgatagtcaaagctggccgttgcttttggagtcgcaccctgagatgatt
cgtgatgcatattcactgggcgagatttatactaaagatgaactcaaattggtgcaggat
tttgctagatctcgtggagtacgcgttataccggaaatcgatatgccgggccatgcaaga
gcaggctggaggcagattgaccccaatatagtcttgtgtggaaatgattggtggggtgat
gtggcggtagagcctcctccaggacaattaaatattatggatctggatacttataagtac
atttccgacgtgtacaatgaactcagcaatgtatttggcgacaaatatttccatgttggg
aacgatgagcttcaaaaaaattgttttccccgtgagtggtttaataatgcaactacactt
ggcgatgtggtccagcactacattgatcgtgccttgcctttgttcaacgctattcctgga
cgtaagttgatgatgtgggacgatgtgctcttgtcgtcagatggagctgctcatagtttg
cctagtaatgttacactccaagtgtggcatgaacagagcggtgtcaagaatttgactctg
caagggtacgaggtggtggtgtcgctgtccagtcacttgtatctcgattgtggctacggt
ggctgggtcacagatgatttccggtatgtagactctcccgaaaatgaagaatttaataat
ggccaaggcggaagttggtgtgctccctacaagacttggcaacgaatctacacgtttgat
attgcacagaatttgactagagaagaatccaagttggtattgggtgccgaagctgtcctt
ttttctgagcaagttgactttactgttttgacgggtaagatttggccaagaacgtcggca
cttgcagaatccttatggagtggcaataagaatgcagagggtgttttccggttagaggaa
atgacgactcgtattttacttttcagagagtttttgataaaagcaggccatcctgcagcg
cccttggtcccaaagtattgcgtgatgaatccgcacgcttgtgacttgaataaaccaaaa
tag

DBGET integrated database retrieval system