KEGG   Lodderomyces elongisporus: LELG_03772Help
Entry
LELG_03772        CDS       T01116                                 

Definition
similar to dihydropteroate synthase
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
lel  Lodderomyces elongisporus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lel00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 848 aa AA seqDB search
MAKDRVLVKDISAVAIIGNDAWNRPTPQPINISVAITTNFLQASVTDNLKHSINYAVLTR
NISEYLKSHENRNLKSLGNIAVAVHKTVLREIDSADKVVEVAVRCPKLEIRADSVEYKLT
RGRGFQGKEQEQEKKKETSDCNGLAGIISTDRVIVNKLRLLTIIGVFTFERLQKQIVDLT
LDFSVGEKNVNLDVRDIVADVVAYVESSNFKTVEALVHSIGRLTFQKHSDLGIKQLVVTV
IKPHAFNHVEGVGVSSTMVSKDFDDLPPIDCELDKKKSDHSNTFTLPATNLTNSFDGLHT
AYLAFGSNSGGDLCASISKALGLLKNYDIDVIATSSMYISKPMYHLNQPDFFNGAVKVQF
KDYSPLKLLEILKEIEYTHMSRRKEFNNGPREIDLDILLYDDLQITLDNLVIPHKSMLER
TFVLQPLCELIPPDYIHPVSAEPIHNHLSQLLKAQVDETMQEDSQLLQYIPIKNRTPAEN
VLKFDQTNFQSQTLIMGILNMTPDSFSDGGKYYDQELDKIVNEAIVMVQDGAHIIDIGGV
STRPGSTEPSEEEELARVLPLVKALRASSSPILKNTLISIDTYRSKVAEQCLEAGADIIN
DVSMGLYDERIFEVVAKYGCPYIMNHTRGTPLTMSKLTNYDPLRDDDIIESVVNFNSDEQ
SMPRVNTEIMYMLNGVARELSLQMLKSFKYGVKKWQIIVDPGVGFAKNMEQNVAIVRNAS
FFKKYSIQLNSARAIGDGGCNGDGGGGIVNDDSPKFESSTEQRSKPTSFDRQYLTFCGMS
VLLGTSRKKFLGTITGEIENKSDRVMATAATVTAGIEQHTDIVRVHDVKDMKDIVKVSDA
IYKGTKHV
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggaccgagttttagtgaaggacatttcggcagtcgctatcattggcaacgat
gcatggaataggccaacgccgcaaccgatcaatatatcagtagcaattaccaccaatttt
ctgcaggcctccgtgacggataatttgaaacatagtatcaattatgctgttttaactcgt
aacatttcagaatatttaaagtcgcatgagaacagaaaccttaaatcgcttgggaatatt
gcagtagctgtgcataaaacagtgctccgtgaaatcgacagcgcagacaaggtggtagaa
gtggcagtgcgctgccccaagttggagatcagagcagatagtgtagagtataagcttact
cgaggaagaggatttcaaggaaaagaacaagaacaagaaaagaaaaaagaaacatcagat
tgtaatggcctggccggaatcatttcgacagacagagtgattgtgaataagcttcgatta
ctaacaattattggagtttttacatttgaaaggctacagaaacaaattgttgatctaact
cttgatttcagtgttggtgagaaaaatgtaaacttggatgttagagatattgttgctgat
gtagtggcatatgtcgaatcatcaaacttcaaaacagttgaggcattggttcattccatt
gggcgcttaactttccaaaaacattccgacctgggaattaagcaacttgttgtaacggtg
attaaacctcatgcgtttaaccatgttgaaggtgtaggtgtttcctcaacaatggtatcc
aaagactttgatgacttgcctccaattgattgtgaacttgataaaaagaaaagtgatcat
agcaatacttttactttgccggctacaaatctgaccaacagttttgatggattacatact
gcatatttggcatttggttccaactctggtggcgatctgtgtgctagtatttcaaaagca
ttaggtttattaaaaaattacgatatcgatgtgattgcaacctcgtctatgtatatttcc
aagccaatgtatcatttaaaccagcctgattttttcaatggtgctgttaaagtgcaattt
aaagattattcacctttgaagttgcttgaaatattgaaagaaatcgaatatactcacatg
tcgaggagaaaagaattcaataacggtccaagagaaattgatcttgatattcttctatat
gacgatttgcaaattaccttggacaatttggtcataccgcataaatctatgctagaaagg
acatttgtactacagccattatgcgagttgatacctccagactatatccatcctgtgagt
gcagaacccattcataaccatttgtcgcagcttcttaaggctcaagttgatgagaccatg
caagaagactctcaactcctccaatatatacctatcaaaaaccgaacacctgctgagaat
gtgctcaaatttgatcaaactaatttccaatcccagacgcttattatgggaatattgaat
atgacaccggactcatttagcgatggaggtaaatattatgaccaagaacttgacaaaatt
gtgaatgaagctatcgttatggttcaagatggtgctcatattattgacattggaggtgtg
tccaccagaccaggaagcaccgagccttctgaagaagaagaacttgcgagagtcttgcct
ttggtcaaggccttgcgtgcctcatctagccctattttgaaaaatactttgatatccata
gatacgtatcgatccaaagttgcagagcaatgtcttgaagctggagcagatatcatcaac
gatgtgtcaatgggtttatacgatgaaagaatctttgaagtggtggccaagtatggatgt
ccgtatataatgaaccatactcgaggtacaccgctgacaatgtcgaaattaacaaactat
gacccacttcgggatgatgacatcattgagtctgtggtaaactttaatagtgatgaacaa
tcaatgccaagagtaaatactgagataatgtacatgttaaatggagttgctagagaattg
tctttacaaatgctcaagagtttcaagtatggagtgaaaaagtggcaaattattgtagat
cctggagtgggatttgccaagaacatggaacaaaatgtcgcaatagtgagaaatgcatct
tttttcaaaaagtactccatacagctcaactcagctcgtgctatcggcgatggcggttgt
aatggtgatggtggtggtggcattgtcaatgatgatagtccaaaatttgaaagttccact
gagcagagatcgaaaccgacatctttcgatcgtcagtatttgactttttgtggaatgagt
gtacttcttggaacatcgagaaagaaatttttgggtacaatcactggagaaatagagaac
aaatcagatagagttatggccacggcggcgactgtgacagcgggtatcgaacaacatacg
gatatagtaagggttcatgatgtcaaagacatgaaagatattgtaaaagtgagtgatgct
atctataagggaacaaaacatgtatag

DBGET integrated database retrieval system