KEGG   Lodderomyces elongisporus: LELG_03795Help
Entry
LELG_03795        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
lel  Lodderomyces elongisporus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LELG_03795
Enzymes [BR:lel01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     LELG_03795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 299 aa AA seqDB search
MPVEELDDKVILTDPSNAKNTATILKYGATVISWKNQDEEKLWLSSAAHLDGSKPVRGGI
PLVFPVFGKQSDSTHPTYKLPQHGFARNSTWEFLGQTTESPVTVQFGLGPENIPSEAQSA
WPYDFTLILTVSLADDKLSTAIEVENTGKEAFEFNWLFHTYYKIHDVTDTLVNNLVDQHC
YDQLIKETYTEKAPAISFHEEFDRKYLNIDERKTLQVIDKGKVLYNLHRTNLPDSVVWNP
WTKKAEGMADFEPKNGFHQMLCVEPGHVNSMIMLPPGDKWKGEQEITVGGEIKIQANIF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttgaagaacttgacgataaagttattctcactgatccatccaacgcaaagaac
actgcaacgattctcaaatacggagcaactgttatttcatggaagaaccaagatgaagaa
aagctttggctttctagtgcggcccatttagatggctctaagcctgttcgtggtggtatc
ccgcttgtgttccccgtatttggaaaacagtccgactcgacgcatccaacttataagctt
ccacaacatggatttgccagaaactcaacatgggagtttcttggtcagactacagaaagt
ccagtgacggtgcaatttggcttgggtccagaaaacattcctagtgaagcacaatcagca
tggccatatgactttaccttgatccttactgtttcgctcgctgacgataagctttccact
gcaattgaagttgaaaacaccggcaaagaggcatttgaattcaactggttattccacacc
tattacaagatccacgatgtcactgatacattggtgaataacctagttgatcaacattgt
tacgatcaactcatcaaggagacatataccgaaaaagcaccggcaatttcattccacgag
gaattcgatagaaagtacttgaatattgatgaaagaaaaacgttgcaagttatcgacaag
ggtaaagtgttgtacaatttgcataggacaaatttgcctgattctgtggtttggaaccca
tggaccaaaaaggcagagggtatggcagactttgaacctaaaaatggattccatcaaatg
ctttgtgtagagcccggacatgtcaactcaatgattatgttgccaccaggtgataaatgg
aaaggagagcaagagattactgttggtggcgaaatcaagatccaagcaaacattttttag

  All links  
No link information was found.   
DBGET integrated database retrieval system