KEGG   Lodderomyces elongisporus: LELG_04033Help
Entry
LELG_04033        CDS       T01116                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lel  Lodderomyces elongisporus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LELG_04033
Enzymes [BR:lel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     LELG_04033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 307 aa AA seqDB search
MSQLAEESKMDLPHKNDITKQQEQQQEPQEQEQEQQQQQQQKESAGSSNSNGTYAAPAAI
HPIKRSKLMSTPSQLNLSSGTPLQTRAASPLILRAPIDSDGLSWPSRGARSRIDQTPEEA
SQREKRISDAVKIILEELGEDTSREGLVETPERYARAMLYFTKGYEENIRDVIKRAVFEE
DHDEMVIVRDIEIYSLCEHHLVPFFGKAHIAYIPNKRVLGLSKLARLAEMYSRRFQVQER
LTKQIAMALSEILKPRGVAVVIEATHMCMVSRGVQKTGSSTTTSCMLGCFRDQQKTREEF
LTLLGRK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaactggctgaagaaagcaaaatggatttgcctcataaaaacgacatcactaag
caacaagaacaacaacaagaaccccaagaacaagaacaagaacaacaacaacaacaacaa
caaaaagagagtgcaggcagctccaactccaatggcacatatgcggcacctgcagcgatc
catcctataaagagatcaaaactcatgtcaactccatcgcaacttaatctcagtagcggt
accccacttcaaacacgtgcagcatcgccattgattttgcgtgctcctattgactctgat
ggtttatcttggccatcacgtggtgcacgatcgagaattgaccaaactcctgaagaggca
tctcaaagagaaaagaggatatcggatgctgttaagattattttggaggaacttggcgag
gatacttctcgtgaaggattggttgaaacacctgagcggtatgctcgtgccatgctctat
ttcactaaagggtacgaggaaaacattcgagacgttattaaaagagctgtttttgaagag
gatcacgacgaaatggttatagtgagggatattgaaatttactcgttgtgcgaacaccat
ttggttccctttttcggaaaggcacatattgcatatatcccaaacaagagagttttgggc
ttgagtaaattggcacgtttggcagaaatgtactcgagaagatttcaagttcaagaaaga
ttaacaaagcaaattgccatggcattgagtgagatcttaaaacctcgtggcgttgctgtg
gtgattgaagcaacccacatgtgcatggtgagccgtggagtacaaaagaccggaagctca
actactacgagttgtatgttgggatgcttcagagaccaacaaaagacaagagaggagttt
ttaacattgctcggaagaaaatag

DBGET integrated database retrieval system