KEGG   Lodderomyces elongisporus: LELG_04039Help
Entry
LELG_04039        CDS       T01116                                 

Definition
(RefSeq) 6-phosphofructokinase alpha subunit
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lel  Lodderomyces elongisporus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LELG_04039
   01230 Biosynthesis of amino acids
    LELG_04039
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LELG_04039
   00030 Pentose phosphate pathway
    LELG_04039
   00051 Fructose and mannose metabolism
    LELG_04039
   00052 Galactose metabolism
    LELG_04039
  Energy metabolism
   00680 Methane metabolism
    LELG_04039
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LELG_04039
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LELG_04039
Protein phosphatases and associated proteins [BR:lel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LELG_04039
Messenger RNA biogenesis [BR:lel03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LELG_04039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1041 aa AA seqDB search
MPSVDSVSRLSYISLITNDQEAFLQLFKFYTNLGFRLTKNFSRVSPNGASAANNPQLQLG
VSKDSLREVWLESYPLQELDDNGNLRPWQEMSIYYGDNCQKLSESTIIKLRLSNEEPASN
AISKKLIFFSTELQKLAKILQDSEKEVKIEKITDSMIDTRDPLGNQLVFSSTIHPLSKTE
YNCAQDYIQQTTHEILKSRNELGDGLNAKNKFRSEISLALDETEAKTRTSTKDGKEIVKK
KKIAVMTSGGDAPGMNPAVRAVVRAGIFYGCDVFAVYEGYEGLVKGGDLLKPMEWADVRS
FLSLGGTAIGTARCKEFREREGRLQAAYNMVINGIDALVVCGGDGSLTGADLFRSEWPSL
VEELVTSGRLTDEQVLPYRHLKIVGLVGSIDNDMSGTDVTIGAYSALERICEMVDYIGAT
ASSHSRAFVVEVMGRHCGWLALLSGIATGADYVFIPERPPKAGQWKQELKEVCARHRSYG
RRKTTVIVAEGAIDDELNPITSEEVKKVLVDLGLDTRITILGHVQRGGTAVAFDRRLATL
QGVEAIKAVLEMTPNTPSPMIGILKNKIVRRPLVDAVKQTQAVAEAIGKKDFDKAMSLRD
ANFYDAYRYYKAITYYDDRSRQLPENRRLNIAVVHVGAASAGLNAATRAITLYNISRGHT
LYAAQDGFEGLAKGHLKKLEWLDVEGWHSRGGSEIGTNRSLPSQDYGRVAYYLQKFNIQG
LIIIGGFEAFKSLHELDVQKANYPIFEIPMVVVPATVSNNVPGSEYSLGSDTCLNQLVTY
CDAVIQSASSSRRRVFVVEVQGGHSGYVASYCGLITGALATYTPEAQINLRELQRDIELL
FTVFQTDRGEDHNGKLIVRNEQASLVYSTELVADILKENANGRFETRTAIPGHVQQGYTP
TANDRVLAVKFALKGMEFIEQWNHITEKDDDDKIKLSTDVSGGNEEEEEGEEGDKEAEDE
EEDAAWKVDNYDDDEDEYRKHNAVVIGIHGDLTEFTNVGTLYETEADVKLRKGKTIHWKD
MIEVEDMLSGKTLLRRKKENL
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atgccgagtgtggattcagttagtcggctcagctacatctcccttataacaaatgaccaa
gaggcatttcttcaactgttcaaattctacacaaatttgggctttagattaaccaaaaac
ttctccagagtctctcccaatggtgcctctgctgccaataacccacagttacaattgggt
gtgtcaaaggattcgctaagagaagtttggcttgagtcttatccattgcaagagttggat
gataatggaaatttacgtccctggcaagaaatgagtatctattatggagacaactgtcaa
aaactctcagagtccaccattatcaaattgagattatctaatgaagagcctgcatcaaac
gcgatatccaaaaagctcattttcttcagtactgaattgcaaaaacttgcaaaaatcttg
caagattctgaaaaggaggtcaaaattgaaaaaatcactgatagcatgattgataccaga
gatccattgggtaaccagttggtcttttcaagcactatacatccattatccaaaactgaa
tacaactgtgctcaagattatatccaacaaactacgcacgaaattttaaagagtagaaat
gaattgggcgacggtttgaatgccaagaacaaattcagatcagaaatcagtttagcattg
gatgagactgaggcaaagactagaacaagcacaaaagatggcaaggaaatagtcaaaaaa
aagaaaatcgctgtgatgacgtctggtggtgatgctcccggtatgaaccctgcagttcgt
gcagttgtcagagccggtatcttttacgggtgcgatgtctttgccgtttacgaaggttat
gaaggattggttaaaggtggtgacttgttgaaaccaatggaatgggctgatgtgcgttca
ttcttatcattgggtggtactgctattggtactgctagatgtaaggagtttagggaacgt
gaaggaagattgcaagctgcatacaatatggtgattaatggtattgatgccttggtagtt
tgtggtggtgatggttcgttaactggtgcagacttgtttagaagcgaatggccatctttg
gttgaagaattggttacttcgggcaggttgacagatgagcaagtgttgccatataggcat
ctcaaaattgttggtttggttgggtcgattgataatgacatgtccggaaccgacgttact
attggtgcctactctgcattggaaaggatctgtgagatggttgattatattggtgccact
gcctcttcgcattctcgagcatttgttgttgaagtaatgggtagacattgtggttggtta
gcacttttatcgggtattgctacgggtgctgattatgtttttatcccagaaagaccgcca
aaagctggccaatggaagcaagaattgaaagaagtttgtgctagacatagatcttatgga
agaagaaagacaaccgtgattgttgccgagggtgcaattgacgatgagttgaatccaatc
acctctgaagaggtcaagaaagtgttggttgatttggggttggatactagaatcaccatt
ttgggacacgtgcagaggggtggtactgctgttgcatttgatagaagattagctacattg
caaggtgttgaagcaattaaggcagttttggaaatgacacccaacacaccttcgccgatg
attggtattttgaagaataagattgttagacgtcccttggttgatgcagttaagcaaaca
caagcggttgctgaggctatcggcaaaaaagactttgacaaggccatgtccttacgtgat
gccaatttctatgatgcttataggtattataaagccatcacttattatgacgataggtca
aggcaattgcccgaaaacaggagattaaatattgctgttgttcatgttggtgctgcatct
gctgggttgaatgccgctacaagggcaataaccttgtacaatatctctcgtggacatacc
ttgtatgcggctcaggatgggtttgaagggcttgcaaaaggtcatttgaagaagttggag
tggttagatgttgaagggtggcacagtagaggtggaagtgagattggtaccaatcgttcg
ttaccctcgcaggattatggaagagttgcttactatttgcaaaaattcaacattcaaggt
ttaatcattattggtggatttgaagcattcaagtctttgcacgaacttgatgttcaaaag
gccaactatccaatatttgagattcctatggttgttgttccagcaaccgtttcaaacaat
gttcctggatcagaatactcgcttggatcagatacttgtttgaaccagttagtgacgtat
tgtgatgctgtcatccaatctgcatcatcaagtcgtagaagagtgtttgtggttgaggtg
caaggtggccactctggttatgttgcatcttattgtggattaattactggtgcgttggct
acatatactcctgaggctcagatcaatcttcgcgaattgcaacgtgatattgagttgtta
tttactgtgtttcaaaccgatcgtggtgaagatcataatggtaaattgattgttagaaat
gagcaggcatcgctggtttattctactgaattggttgccgatattcttaaggagaatgct
aatggcagatttgagactcgtactgcaattccaggtcacgttcaacaaggatatacgcct
acagcaaacgatcgtgttcttgcagtgaagtttgcattaaagggaatggagtttattgaa
caatggaatcatattactgaaaaggatgatgatgataaaatcaagctttctacagatgtt
agtggtggtaatgaggaagaagaagaaggagaagaaggagacaaagaggcagaggatgaa
gaggaagatgcagcatggaaggtggataattatgatgatgatgaagacgagtataggaaa
cacaatgctgttgttattggtattcatggagacttgacagagttcacgaatgttggtaca
ttgtatgagactgaagcagatgtcaagttgagaaaaggtaagaccatccattggaaggat
atgattgaggttgaagatatgttgagtggtaagacgctacttaggaggaagaaggaaaac
ttgtaa

DBGET integrated database retrieval system