KEGG   Lodderomyces elongisporus: LELG_04039Help
Entry
LELG_04039        CDS       T01116                                 

Definition
6-phosphofructokinase alpha subunit
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lel  Lodderomyces elongisporus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:lel01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lel01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lel00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lel00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lel00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lel00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:lel00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1041 aa AA seqDB search
MPSVDSVSRLSYISLITNDQEAFLQLFKFYTNLGFRLTKNFSRVSPNGASAANNPQLQLG
VSKDSLREVWLESYPLQELDDNGNLRPWQEMSIYYGDNCQKLSESTIIKLRLSNEEPASN
AISKKLIFFSTELQKLAKILQDSEKEVKIEKITDSMIDTRDPLGNQLVFSSTIHPLSKTE
YNCAQDYIQQTTHEILKSRNELGDGLNAKNKFRSEISLALDETEAKTRTSTKDGKEIVKK
KKIAVMTSGGDAPGMNPAVRAVVRAGIFYGCDVFAVYEGYEGLVKGGDLLKPMEWADVRS
FLSLGGTAIGTARCKEFREREGRLQAAYNMVINGIDALVVCGGDGSLTGADLFRSEWPSL
VEELVTSGRLTDEQVLPYRHLKIVGLVGSIDNDMSGTDVTIGAYSALERICEMVDYIGAT
ASSHSRAFVVEVMGRHCGWLALLSGIATGADYVFIPERPPKAGQWKQELKEVCARHRSYG
RRKTTVIVAEGAIDDELNPITSEEVKKVLVDLGLDTRITILGHVQRGGTAVAFDRRLATL
QGVEAIKAVLEMTPNTPSPMIGILKNKIVRRPLVDAVKQTQAVAEAIGKKDFDKAMSLRD
ANFYDAYRYYKAITYYDDRSRQLPENRRLNIAVVHVGAASAGLNAATRAITLYNISRGHT
LYAAQDGFEGLAKGHLKKLEWLDVEGWHSRGGSEIGTNRSLPSQDYGRVAYYLQKFNIQG
LIIIGGFEAFKSLHELDVQKANYPIFEIPMVVVPATVSNNVPGSEYSLGSDTCLNQLVTY
CDAVIQSASSSRRRVFVVEVQGGHSGYVASYCGLITGALATYTPEAQINLRELQRDIELL
FTVFQTDRGEDHNGKLIVRNEQASLVYSTELVADILKENANGRFETRTAIPGHVQQGYTP
TANDRVLAVKFALKGMEFIEQWNHITEKDDDDKIKLSTDVSGGNEEEEEGEEGDKEAEDE
EEDAAWKVDNYDDDEDEYRKHNAVVIGIHGDLTEFTNVGTLYETEADVKLRKGKTIHWKD
MIEVEDMLSGKTLLRRKKENL
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atgccgagtgtggattcagttagtcggctcagctacatctcccttataacaaatgaccaa
gaggcatttcttcaactgttcaaattctacacaaatttgggctttagattaaccaaaaac
ttctccagagtctctcccaatggtgcctctgctgccaataacccacagttacaattgggt
gtgtcaaaggattcgctaagagaagtttggcttgagtcttatccattgcaagagttggat
gataatggaaatttacgtccctggcaagaaatgagtatctattatggagacaactgtcaa
aaactctcagagtccaccattatcaaattgagattatctaatgaagagcctgcatcaaac
gcgatatccaaaaagctcattttcttcagtactgaattgcaaaaacttgcaaaaatcttg
caagattctgaaaaggaggtcaaaattgaaaaaatcactgatagcatgattgataccaga
gatccattgggtaaccagttggtcttttcaagcactatacatccattatccaaaactgaa
tacaactgtgctcaagattatatccaacaaactacgcacgaaattttaaagagtagaaat
gaattgggcgacggtttgaatgccaagaacaaattcagatcagaaatcagtttagcattg
gatgagactgaggcaaagactagaacaagcacaaaagatggcaaggaaatagtcaaaaaa
aagaaaatcgctgtgatgacgtctggtggtgatgctcccggtatgaaccctgcagttcgt
gcagttgtcagagccggtatcttttacgggtgcgatgtctttgccgtttacgaaggttat
gaaggattggttaaaggtggtgacttgttgaaaccaatggaatgggctgatgtgcgttca
ttcttatcattgggtggtactgctattggtactgctagatgtaaggagtttagggaacgt
gaaggaagattgcaagctgcatacaatatggtgattaatggtattgatgccttggtagtt
tgtggtggtgatggttcgttaactggtgcagacttgtttagaagcgaatggccatctttg
gttgaagaattggttacttcgggcaggttgacagatgagcaagtgttgccatataggcat
ctcaaaattgttggtttggttgggtcgattgataatgacatgtccggaaccgacgttact
attggtgcctactctgcattggaaaggatctgtgagatggttgattatattggtgccact
gcctcttcgcattctcgagcatttgttgttgaagtaatgggtagacattgtggttggtta
gcacttttatcgggtattgctacgggtgctgattatgtttttatcccagaaagaccgcca
aaagctggccaatggaagcaagaattgaaagaagtttgtgctagacatagatcttatgga
agaagaaagacaaccgtgattgttgccgagggtgcaattgacgatgagttgaatccaatc
acctctgaagaggtcaagaaagtgttggttgatttggggttggatactagaatcaccatt
ttgggacacgtgcagaggggtggtactgctgttgcatttgatagaagattagctacattg
caaggtgttgaagcaattaaggcagttttggaaatgacacccaacacaccttcgccgatg
attggtattttgaagaataagattgttagacgtcccttggttgatgcagttaagcaaaca
caagcggttgctgaggctatcggcaaaaaagactttgacaaggccatgtccttacgtgat
gccaatttctatgatgcttataggtattataaagccatcacttattatgacgataggtca
aggcaattgcccgaaaacaggagattaaatattgctgttgttcatgttggtgctgcatct
gctgggttgaatgccgctacaagggcaataaccttgtacaatatctctcgtggacatacc
ttgtatgcggctcaggatgggtttgaagggcttgcaaaaggtcatttgaagaagttggag
tggttagatgttgaagggtggcacagtagaggtggaagtgagattggtaccaatcgttcg
ttaccctcgcaggattatggaagagttgcttactatttgcaaaaattcaacattcaaggt
ttaatcattattggtggatttgaagcattcaagtctttgcacgaacttgatgttcaaaag
gccaactatccaatatttgagattcctatggttgttgttccagcaaccgtttcaaacaat
gttcctggatcagaatactcgcttggatcagatacttgtttgaaccagttagtgacgtat
tgtgatgctgtcatccaatctgcatcatcaagtcgtagaagagtgtttgtggttgaggtg
caaggtggccactctggttatgttgcatcttattgtggattaattactggtgcgttggct
acatatactcctgaggctcagatcaatcttcgcgaattgcaacgtgatattgagttgtta
tttactgtgtttcaaaccgatcgtggtgaagatcataatggtaaattgattgttagaaat
gagcaggcatcgctggtttattctactgaattggttgccgatattcttaaggagaatgct
aatggcagatttgagactcgtactgcaattccaggtcacgttcaacaaggatatacgcct
acagcaaacgatcgtgttcttgcagtgaagtttgcattaaagggaatggagtttattgaa
caatggaatcatattactgaaaaggatgatgatgataaaatcaagctttctacagatgtt
agtggtggtaatgaggaagaagaagaaggagaagaaggagacaaagaggcagaggatgaa
gaggaagatgcagcatggaaggtggataattatgatgatgatgaagacgagtataggaaa
cacaatgctgttgttattggtattcatggagacttgacagagttcacgaatgttggtaca
ttgtatgagactgaagcagatgtcaagttgagaaaaggtaagaccatccattggaaggat
atgattgaggttgaagatatgttgagtggtaagacgctacttaggaggaagaaggaaaac
ttgtaa

DBGET integrated database retrieval system