KEGG   Lodderomyces elongisporus: LELG_04051Help
Entry
LELG_04051        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
lel  Lodderomyces elongisporus
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lel00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LELG_04051
Enzymes [BR:lel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     LELG_04051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 349 aa AA seqDB search
MLIHLQTILLILQLLLRVTARAQGDEYRNDPNIIELSSHNFDKLVHGTNYTTIVKFYAPW
CGYCQQLKPIWKKLGKYITRDSQLGINVASLNCDNPENKPLCSTYQIQGFPTLMVFRPPK
FDKTAGKSSSASTEAKKRKRHASEVYNGQRTLKAISTFLTSRLKNYVTKLHNLDKDLQTW
IEQNKDVPRMLLIAKANLISPLLKTLAIDYLGLVEFAMIGKYNEDEKTINIEGREVVVPI
TDKSSLFYYDAEAGKLIKYQETEKLNDKLEIEKWVSKVTGVEPIEGSLSTKGKKIDKARG
SSKSITNGRNGKSSKKGEKEKNGRNENREKSGKNGSGAKKESNVEHDEL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgttgatccatctccaaaccattttactaattttgcagctccttcttcgggtcacggct
cgggcacaaggtgatgagtacagaaacgaccccaatataatagagctttcatcacacaat
ttcgataaattggttcatggcacaaattatactacaatagtcaaattctatgctccttgg
tgtggttattgtcaacagctcaaacctatctggaaaaaattgggaaaatacatcactagg
gattctcaattggggatcaacgttgctagtttgaattgtgataatcctgaaaacaagccc
ttatgttccacctatcaaatccaaggattccctacgttgatggtatttagaccacccaag
tttgataaaacagctggcaaaagcagtagtgctagtaccgaagctaagaagagaaagagg
catgcaagcgaagtttataatgggcaaagaactttgaaagcaatctccacatttctcacc
tcacggttgaaaaactatgtaacaaagttacataacttggataaggacttgcaaacgtgg
atagaacaaaataaagatgtacctcgtatgttgctaattgcaaaagcaaatctgataagt
ccgttgttaaagactttggcaattgattacttgggcctagttgagtttgcaatgattggt
aaatacaatgaggacgaaaaaacaatcaacattgagggaagagaagttgttgtgccaata
actgataaatcgagtttattttattatgatgcagaggcggggaagttgataaaataccaa
gagacggagaaattgaacgataagcttgaaattgaaaaatgggtatcaaaagtaacgggt
gttgagccaattgaagggtctttgtctactaagggaaagaagattgataaggcgaggggc
agtagcaaaagcataacaaacggaaggaacggaaagagcagtaaaaagggagaaaaagaa
aagaatggaagaaacgaaaatcgtgaaaagagtgggaagaatgggagcggtgccaaaaaa
gaaagtaatgtagaacatgacgagttgtag

DBGET integrated database retrieval system