KEGG   Lodderomyces elongisporus: LELG_04074Help
Entry
LELG_04074        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     LELG_04074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 429 aa AA seqDB search
MEMKALFSSLRILVTKIISFVLVPLAFLQSLYSDFPGEYVFDRAYYLADRYLIKALFFAV
FAYKLRYRKQIYLHNGFPLQRYQGYNVYLRFKCGCPKALKKKGTPLTRPMIDSAFKVPAT
DPNYILQVQFAIKDIFAVNHEVGSLAPIFFKLAWYCCATYDANTLLSGSSGGSSGGSSGA
TIRFEPEFFDKEIMVLNVARNALEQVKCNFPEISYADLWTLAGKLAIEEMGGPTIKWLPG
RSDYVNTEYVAPQGLLPFGNKNTDHIISIRRTFTRLGLDDQETVALIGAHGLGRCYKYTG
DCEGQWNRGLLRFSNEFFRVLISESWHQEIVPEAGGVQYYNIDNSLRMLNTDMELLRDPS
YKIWVQEYAKDENRYFKDFAEAYAKLLDLRIRRDAKGTVILQESYKYKQRRSKRESRDDR
NRTDIVDKI
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaaagccctgttcagctcattacggatactagttacaaagattatctcgttt
gttttggtaccattggcttttctccaatcactttattctgatttccctggtgaatatgtg
tttgatagagcttactatttagctgataggtatcttataaaggcattattctttgcagtt
tttgcttataagctcaggtaccgaaaacaaatatatctacataatggctttcctttacaa
cggtaccaaggttataatgtatatttgagatttaaatgtggttgtccaaaagcgctaaag
aaaaaaggaacaccattaacccgcccaatgattgattcagcattcaaagtaccagcaaca
gatcccaactacattcttcaggttcaatttgcaatcaaggatatatttgctgtaaaccat
gaggttggctcgttggcgcctattttctttaaattggcgtggtactgttgtgccacatac
gatgctaacaccctgttaagcggctccagtggcggctccagtggcggctccagtggcgcc
accataagatttgaaccagagttttttgataaagaaattatggttttaaatgttgcacga
aacgcactagagcaagttaaatgcaatttcccagaaatctcatatgctgacttgtggaca
ttagccggaaagctagctatcgaagaaatgggtggccccactataaagtggttgcctgga
aggtctgattatgtgaatactgaatacgtcgcgcctcaaggtttgctaccatttggaaat
aagaacacagatcatattattagtattaggcgtacattcacaagactaggacttgatgat
caagaaacagttgcattgatcggagcacatggactaggaagatgctataagtataccggt
gactgtgaaggacaatggaatagaggtctgcttcgtttttcaaatgagtttttcagagtt
ttaatatcggaatcttggcatcaagagatagtccctgaggcgggaggagtacaatattat
aatatcgataacagtctcagaatgcttaatactgatatggagttgcttcgggaccctagc
tacaaaatttgggtccaagagtatgcaaaagatgaaaatagatacttcaaggattttgct
gaagcatatgctaaattactagacttgcgaatccgtagagatgctaaaggaactgtgatt
ttacaagaatcgtataaatacaagcaaagaagaagcaaaagagaatcgagagacgaccga
aataggaccgatatagtagataaaatttga

DBGET integrated database retrieval system