KEGG   Lodderomyces elongisporus: LELG_04390Help
Entry
LELG_04390        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
lel  Lodderomyces elongisporus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 793 aa AA seqDB search
MSRQRQHSNNPYDTDSEEESLIEAFETTLSIRPSTTDYEDDISIDHTVLPNTTINYTHDL
SSIVDIEELEENEQISEQIPKFKTNRRYSLLPRLTAYKKTGSPGLEEYYNQQKLDPKFDE
ILKPNPLLDEKLIKYHHTFSDFIASNPHINTESPRFSLESEKTLIILSPYSPEHAFGRKW
VTKTYLSTIFERPQRLLASCIGVASAITMYPFYYKLINSTKRSSIFSSHVRKIHGRNWPK
KLFELCLESHDKLENDELEVPKDWNTGDIYLTPKTINAIEGVIGTIETAVDQLFKQSTTS
SAASASGLATATATSTSTAMAAEPLSSKSTTSTTAANNNNNIGLNGGSSKKKPNHNLAFV
VIRPPGHHSHACLPSGFCLLNNVQIGIEYAFETYGVTHCAILDIDLHHGDGSQDICWERG
GFTGDYGQQDEDEIVDPSLNPRDDYGKRFATYPKVGYFSLHDIKSYPTELGFATKENIKN
ASTCIMDHDLNIWNVHLQSWASEDEFYKHYLTKYVAILNRANQFLNNSKKQYEEEYQEYL
VQLAKYNKMLTKPKHLLSNNDLKLQKPTPPPPYKPLIIISAGFDASEYENPQMQRHGINV
PTSFYANFTRDVVKLAKLQTGGKVISFLEGGYSDGALSTGIFSHLIGLNNDDDLAWNHSW
GSEQVVKELCKGCKKNWTPYKHPKTDITIWANEVIKLGRSMMPNAILPANYIYRDASKDN
GGTGGVGGDTKPVNRMVKGLMDARGSMGIIESPKLKREKQETGFGGSGGGVDGGSSVAGN
VRHTRSYYKRVGG
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgacagagacaacatagcaataatccctatgacactgacagcgaggaggaatcc
ttgattgaagcatttgaaaccacactcagcatcagacccagtaccacggattatgaagac
gatatctccattgaccatacagtattacctaatactacgatcaactatacgcacgacctt
tccagcatcgtagatatcgaagaactcgaagagaatgagcagatctcggagcagattcca
aaattcaaaactaatagacgatatagtctcttacctcgattgacagcatacaaaaagact
ggatctcctggccttgaggagtattacaatcaacaaaaacttgaccccaagtttgatgaa
attttaaaacccaacccgctattggatgaaaagttgatcaaataccatcatacttttagt
gactttattgcatcaaatccacacatcaatacagaatcgccacgatttagcttggaatcg
gagaaaacgttgatcatattatcgccatactcacctgaacatgcatttggcaggaaatgg
gtaaccaagacgtatttgtccacaattttcgagcgtcctcaacgattattagcaagttgt
attggtgttgcttcagcaatcacaatgtaccctttctattacaaacttatcaactcgact
aaacggtcatcaattttttcttcacatgttaggaaaattcatggacgcaactggcccaag
aaactttttgaattgtgtttggaaagccatgacaaattggaaaacgacgagttggaagtg
cccaaggattggaacactggtgacatttacttaactccaaagacaataaacgcaattgaa
ggtgttattggaacgatcgaaactgcagtagatcaactatttaagcaatctacaacgtcg
tcagcggcatcggcatcgggattggcaacggcaacggcaacatcaacatcaacagcaatg
gcggcagaacccttgtcttctaaaagcaccacctccaccaccgccgccaacaacaacaat
aatataggtttgaatggaggatcaagcaaaaagaaacccaaccacaatttggcatttgtt
gtgattcgtccaccgggacaccatagccacgcctgtttacctagtggattttgtcttttg
aacaatgtccaaattgggatagaatatgcatttgaaacgtatggtgtgactcactgtgca
atattggatattgatctacaccacggtgatggatcacaggatatatgttgggaaagaggt
gggttcacaggtgattatgggcaacaagatgaggatgagattgtggaccctagtctaaac
ccacgagacgattatggcaagaggtttgcaacgtatccaaaagttggctatttctcattg
catgatatcaagtcctaccctacggagcttggtttcgcaaccaaggagaacatcaaaaat
gcatcaacttgtataatggatcatgacttgaatatctggaatgtccacttacagtcatgg
gccagtgaagatgagttttacaagcattatctgacgaaatacgttgccattcttaatagg
gcaaaccagtttttgaacaattcaaagaaacaatatgaagaagagtaccaggaatacctc
gtgcagcttgccaaatacaacaagatgcttactaaaccaaagcacttgttgtctaataat
gacttgaagcttcaaaagcctacgcctccacctccatacaagccactaattataatttct
gctgggtttgatgcttctgaatacgagaatccacaaatgcaaagacatgggatcaatgtg
cccacctccttttatgccaactttacacgtgatgtggtcaaactagccaaattacaaact
ggtggtaaagttatatcatttcttgagggtggttattctgatggtgcattatccaccgga
atcttttcgcatctcattgggttaaataatgatgacgacttggcttggaatcattcgtgg
ggttcagaacaggttgtcaaggagttgtgtaaaggatgcaagaagaattggaccccgtat
aagcatccaaaaacagatatcacaatctgggctaacgaggtgatcaagttgggcagatcg
atgatgcctaatgccatattaccggcaaattacatttatagagatgcatcaaaagataat
ggtggaactggtggagttggcggagacacaaagccagtgaatagaatggtgaaagggttg
atggatgcaagaggaagcatggggattattgagagtcccaaactaaagagggagaagcaa
gagactggttttggtggaagtggtggtggagtagatggagggtcgagtgtagcaggaaat
gtcagacatacgagatcctactacaagcgtgttggtggttga

DBGET integrated database retrieval system