KEGG   Lodderomyces elongisporus: LELG_04492Help
Entry
LELG_04492        CDS       T01116                                 

Definition
similar to ubiquitin-specific protease
Orthology
K11873  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LELG_04492
Peptidases [BR:lel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LELG_04492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 875 aa AA seqDB search
MYAAPIPIPPPTPPPSSSSSSSGPPSEPKVSNPIVHHLKGNKKNKKKTDSSNSSSATTTN
PILQRYLTTPINFKPAKRPESISSIDKLPSSYIVLSKNSLNRDNTENDSMKMRGNSNGTL
LGNDSSQSKKKSNVNRPKSLAEAVASYKGNKYERAKSRKRKRKLEELVREDLDNKDDHDD
YDDVYDDDDDDDDDDDDDDDRDEDNEKEEFGGEPGWKTRMNGENVETGGNKSLGSIYKQQ
QFKHQKDEHNGQPPLKKPKGIWGSLKSLFGSTPPASTDGEDGDEDVGEEYVEGEDLDIDG
SDLNSSKHKSFGLTEIVKKVTGGRCDGEDYDNDYDNEDLSTSSSSSSAGEVYDENSPFTG
FSEAEKSDANQSERDDLEEEDIEESLENEDESEDVEYKDDNSEDEEDEKDEFSPGSSSQE
HSPDVDADLSKLRADLKLDELINGLGRDVADSNVVDQGTKERKDKVRGEANLVNNALKAG
KRTSVGIKINSTPPTSPEEFAEDGGKIAFYNINELDLDRGSNGSKRIYKNWRGVQQQTKG
PIGLLNHGVTCYMNSAIQSLIHIPAVQHYLDEISQGKVSNLKPRSVSHVLAELSRKMWAP
KNSKAMYINPKKLIQRLDEINCMMSEWQQEDSHEYYMSLMSRLQEDSTPKGKKLNESIIY
DIFGGLLNQKITCLRCGNISITKQEFYDLSLGLNKRKLLNNGGSGGMSNDIPALSSSKFS
IEKSIADFFSNETIKKTDADKKSGYYCEQCHEFTQANKISSIIRAPETLTVHFKRFKFNG
NSLSKVKQSIGYSKYLDLSAYMEHETDSAYYRLISVIVHEGRLISSGHYITHVLQPNGQS
WATYDDEYINPIEERKALNDPNAYVLVYTKLTPKH
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcagcaccaataccaataccaccaccaacacctccaccttcatcgtcttcctcc
tcatctggaccgccatcggaaccaaaagtgtcgaatcctattgtgcatcacttgaaagga
aataagaaaaacaagaaaaagacagattcatccaactcttcctctgctacaaccaccaat
cccattcttcaacgatatctcacaacacccataaatttcaagcctgcaaaacgtcctgaa
agtatatctagtattgacaaattaccttcctcctatattgtgctatcaaaaaatagttta
aatagagataatacggaaaacgatagcatgaaaatgagagggaatagcaatggaacattg
ttagggaatgatagttcacaaagcaagaagaagagcaatgtgaatagaccaaagtcattg
gcagaggcagttgcatcttacaagggaaataagtatgagcgtgccaagagccgaaaaagg
aagcggaagttggaggaacttgttcgcgaagatctggacaataaagatgatcatgatgat
tatgatgatgtttatgatgatgatgatgatgatgatgatgatgatgatgatgatgatgat
cgtgatgaagataacgagaaggaagaatttggtggagagcctggttggaaaacgcgtatg
aacggtgaaaatgtagaaacaggaggcaacaagagcctaggatcaatttataaacaacag
caatttaaacaccagaaagacgagcacaatggacaaccacctttaaagaagccaaaaggc
atatggggctcactcaagtcattgtttggttcaactccacctgcatcaactgatggtgaa
gatggagatgaagacgtaggtgaggagtacgttgaaggagaagacctcgatatcgatggt
agtgacctgaacagttccaaacataaaagttttggacttacggaaattgttaaaaaagtt
acaggtggtcgttgtgatggcgaagattacgataacgattacgataacgaagacctctcc
acctcatcatcgtcgtcatctgcaggtgaagtatatgatgagaattcaccattcacaggt
ttcagcgaggcggagaaaagcgacgccaatcagagtgagagggatgatttagaggaagaa
gacattgaggaaagtctggaaaatgaggatgaaagtgaagatgtcgaatacaaagatgac
aatagcgaagatgaagaagacgaaaaggatgaattttcacctggttcaagttctcaggaa
cactcaccagatgtggatgcagatttaagcaaactcagagcagatttaaaactcgatgaa
ttgatcaatggactgggccgtgatgttgcagatagcaacgttgttgatcaaggaacaaaa
gaaagaaaagacaaagtaagaggagaagccaatttagtaaacaacgcactcaaagctgga
aagagaaccagtgttggaatcaaaattaactcgactccgccaacttcaccagaagaattt
gcggaagatggtggtaagattgcattttataatattaacgaacttgacctggacagaggc
tcaaatggatccaagaggatatacaagaactggaggggtgtccaacaacaaaccaaagga
ccaatagggttattaaatcatggtgtaacttgttatatgaactctgctatacaatcactt
atccacatccctgccgttcaacattacttggacgaaatttcacagggtaaagtatctaat
ctcaaacctcgctcagtgagccacgttcttgctgagttatcacgtaaaatgtgggcacct
aaaaactccaaagcaatgtacatcaaccccaaaaagttaatccaacggttagatgagatc
aattgcatgatgagtgaatggcagcaagaggatagccatgaatattacatgagtttgatg
tcacgactccaggaggatagtactccaaagggtaagaagttgaatgagtccattatttat
gatatttttggtggattgttgaaccaaaagattacatgtttgagatgtggaaatatctct
ataacaaagcaggaattttatgatctctcgttggggttgaataaaaggaagctcctcaat
aatggtggatcaggaggtatgagtaatgatataccagctctttcttcttccaagttttca
attgaaaagtcgattgctgatttcttttcaaatgaaacaattaaaaaaactgatgcagac
aaaaagtctggatattattgtgaacaatgtcatgagtttactcaagctaataagatcagc
agcatcattcgtgcaccagagacattaactgtgcatttcaagcgatttaaattcaatggc
aactctctgtccaaggtcaagcaatctattggatatagcaaataccttgatctttcagca
tatatggagcacgagacagactcggcgtattatagattgatctcagtgattgtgcatgaa
ggaagactgattagttctggacattatatcactcatgttcttcaacccaatggacagagc
tgggctacgtatgatgatgagtatattaaccctatcgaagagagaaaggcattgaatgat
ccaaatgcctatgtcttggtgtatacgaaattgacgcctaaacactag

DBGET integrated database retrieval system