KEGG   Lodderomyces elongisporus: LELG_04521Help
Entry
LELG_04521        CDS       T01116                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
lel  Lodderomyces elongisporus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LELG_04521
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LELG_04521
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LELG_04521
Enzymes [BR:lel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LELG_04521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 706 aa AA seqDB search
MSQHLRETFARCKKEGRNALVNFITVGYPTVEDTIPILKGMQDAGTDIIELGVPFSDPIA
DGPTIQTANIKALENGITVPKVLELVTKARESGVTVPLILMGYYNPILKYGENQFLEDAE
KAGANGFIIVDLPPEEAVKFRSSCAKYGLSYVPLVAPATTDERLKVLGQIADSFIYVVSK
MGTTGASSKVSSGIDELCARVRKFAGAETPLAVGFGVSTREHFLEVGKVADGVVIGSKIV
TLIGESAPGKRGETAYNYVKSILGQDYKSNAPSTYSRSDLSKEQRESKPILEEAHKFNPR
FGDFGGQYVPEALHSCLAELEKGFEDAVADPEFWKEFRDLYSYIGRPSSLHKAERLSEHA
GGATIWLKREDLNHTGSHKINNALAQVLLAKRLGKKKIIAETGAGQHGVATATACAKFGL
ECTVFMGAEDTRRQALNVFRMKILGATVIPVKNGTQTLRDATSEAFRYWVSNLETTHYVV
GSAIGPHPYPVLVRTFQSVIGQETKEQFKQLNDGKLPNAVVACVGGGSNSTGMFSPFEKD
VEVKMLGVEAGGDGIDTERHSATLTAGIPGVFHGVRTYVLQDSDGQVHDTHSVSAGLDYP
GVGPELAFWKSTGRAEFIAATDAQALQGFRLLSQLEGIIPALESSHAIYGGVELAKKLPK
DQHIVINVSGRGDKDVQSVAEVLPKLGEQIGWDLRFDEDPSKKNEV
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaacatttaagagaaacttttgcaaggtgtaaaaaagaaggccgcaatgcgctt
gtcaactttatcactgtaggataccccacagttgaagatacaattcctattttgaaaggg
atgcaagatgccggaacagatataattgagcttggtgtaccattttcagaccctatagcc
gatggcccaaccattcaaactgccaacatcaaagccttggagaatggaatcacagttcca
aaagtcttggagttggtgacaaaggctagagaaagcggagtcactgtgcctttaatttta
atgggatactacaatccaatcttgaagtacggagagaaccaatttttggaagatgcagaa
aaagctggtgccaatggttttattattgtggacttgccaccagaggaagcagttaaattc
agatcatcgtgtgccaaatatgggttgtcatatgtccccttggtcgcacccgctacaact
gatgaaaggttgaaagttttgggacaaattgctgattcatttatctacgttgtgtcaaag
atgggtactactggtgcctcaagcaaagtctcatctggtattgatgagttatgtgcacgt
gtgagaaagtttgccggcgcagaaacacccttggcagtaggattcggtgtttctacgcga
gagcactttttggaagttggtaaagttgcagatggtgtggttattggctcaaagattgtg
actttgattggtgagtctgcaccaggaaagagaggcgagactgcttacaactatgtcaaa
tcgattttgggacaggattacaaatctaatgcaccttccacttatagtaggtcagatctc
agcaaagagcaacgcgaatcgaaacctattttggaagaggctcacaagtttaaccctaga
tttggagattttggaggtcaatatgttcctgaggcattacactcttgtttagcggaatta
gaaaaagggtttgaagatgcagttgcagatccggaattctggaaagagtttagagacttg
tactcctatattggtcgtccatcatcattgcacaaagcggaaagattatctgaacatgca
ggtggtgcaaccatttggttgaagcgcgaggatttgaaccataccggatcccacaagatt
aataatgcattagcccaagtattgctcgctaaacgtttaggtaagaagaagatcattgcc
gagaccggtgctggccaacacggtgttgccactgccacagcttgtgccaagtttggactt
gaatgtacggttttcatgggtgccgaagatactagacgtcaagcattgaatgtgtttaga
atgaagatcttgggcgccacggttatcccagtcaagaatggtactcaaacattgagggat
gcaacttcagaggcttttagatactgggtttccaatttggagactacacattatgttgtt
ggttcagcaattggcccacatccataccctgttttagtgagaacattccaaagtgttatt
ggacaagaaaccaaagagcaattcaaacaactcaatgatggcaaacttccaaatgcagtg
gttgcatgtgtaggtggtggttccaactctactggtatgttctcaccatttgagaaagat
gtggaagtcaagatgttgggtgtagaagctggtggtgatggtattgatactgagcgtcac
tcagctacattaacagcaggtattcctggtgttttccatggtgttagaacatatgttttg
caagacagcgatggacaagtgcacgatacacactcagtctctgcaggtttggattaccca
ggtgtgggtcctgagttggcattctggaagagtacgggtcgtgccgaattcattgctgct
acggatgcacaagccttgcaagggtttagacttttatcgcaattggaaggtattattcca
gccctcgagtcctcgcatgctatctatggcggtgtagagttggccaagaaattacccaag
gaccagcatattgttataaacgtttctggaagaggtgataaggatgttcaatctgttgct
gaggtgttgcctaaattgggtgaacaaatcggatgggatttaagatttgacgaagaccct
tcaaagaaaaatgaagtttga

DBGET integrated database retrieval system