KEGG   Lodderomyces elongisporus: LELG_04559Help
Entry
LELG_04559        CDS       T01116                                 

Definition
NADPH-cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
lel  Lodderomyces elongisporus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 315 aa AA seqDB search
MALDSLDLYVVIILTLSVAAYFAKGYFFDKPESTGFLNADGGAGGVGGINSRNILEVLAK
NNKNALLLFGSQTGTAEDYCNKMSKELSSRFGLHTMVADFADYDWEKFEEIKEETLVFFL
MATYGEGEPTDNAIEFMEYLENEADTLSSLRFTVFGLGNSTYEFYNAIGRKLNTTLEEKG
AERFAEYGEGDDGLGTLDEDFLSWKDNVFDSLRNNLSLEEKELKYEPSVKVIERDDLTKD
DNSVSLGEPNKKHIAGDVDLTKGPFDHTHPYIAQITATKELFNTKERSCVHVEFDLSDSN
LKYTTPPAFGCLATE
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcattagattcattagacttgtacgtggtcatcatcttgaccttatccgtggcagct
tattttgccaaagggtacttttttgacaaaccagaatccactggtttcctcaatgccgat
ggtggtgctggcggtgttggcggtataaattcaaggaacattttggaagtgttggccaaa
aacaacaaaaatgctttattgttgtttggttctcaaacaggtactgctgaagattattgt
aacaagatgtccaaagaattgagctcccgttttggcttgcacaccatggttgctgatttt
gctgattacgactgggagaaatttgaggaaatcaaagaagaaacattggttttcttcctt
atggccacttatggtgaaggtgaacccactgataatgctattgaatttatggaatacttg
gaaaacgaggcagatacattgagttcattgagatttaccgtatttggattgggtaactct
acttatgaattttacaatgccattggtagaaaattaaacacaacattggaggaaaaaggt
gccgagagatttgccgagtatggtgaaggtgatgatggtttgggaactttggatgaagat
ttccttagttggaaagataatgtgtttgactctttgagaaataacttgagtttggaagag
aaggagttgaaatacgagccaagtgttaaagttatcgaaagagacgacttgacaaaggac
gataattccgttagtttgggagaaccaaacaagaaacacattgctggagacgttgacttg
accaaaggaccatttgaccacactcacccatacattgcccaaattactgcgactaaagaa
ttgttcaacaccaaggagagatcctgtgtccatgttgaatttgaccttagtgactcgaac
ttgaaatatacaaccccacccgcatttggctgtttggccacagaatag

DBGET integrated database retrieval system