KEGG   Lodderomyces elongisporus: LELG_04604Help
Entry
LELG_04604        CDS       T01116                                 

Definition
glycogen debranching enzyme
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
lel  Lodderomyces elongisporus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lel00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1524 aa AA seqDB search
MTNTRLILFRLSNLGEPVNNENIKNGVLTLPADDYPQGFKSGDALFELRFQLNAASQVSR
KGVFHTNVPKSFDIDFDRNKHNAYPIESSFHQDITINIPIYKPGAYNYYFTYEDENGNEK
ETAKFYFNVPPHLELDGKFVPFNSINVETVVSKWIGPYERWNKFFGIVKAKGYNMVHFTP
LQQRGESDSPYSIYDQLKWDPKIFSDQSKATKEIHKVLNDNKLLSITDVVWNHTANNSEW
LKSAPESGYTQDTAPHLNAAIELDAKLLEFSEKLEDLGLPTAIESEDDLQKIVTALKSQV
HDELKLWQYYVFDRKKEVEKVLDTFKSGSDISKAQIPSSVNTNDLNQIAQYTLENASDNK
QAILGRRFENELNPRSFLSILYAILGDSVEENALKAKVGEIVDEINAPFYAQYDDDVKTI
DQQVADRIRFLRLADNGPRLGKITEKNPLTEPYFTRFVDANGKKQALANNGWIWGGNPLV
DFASNKSKAYLRREVIVWGDCVKLRYGAKYEDSPKLWDRIIEYTKEMARVFNGFRIDNCH
STPLPVAERLLDEARKVNPDLYVIAELFSGSEEMDKIFVERLALNSLVREAMQAWSVAEL
STLVHKHGGRPIGSLTWLPLSEFSYPASKEPKLDSSHGGYTEMEIPKVLTSTAPHAIFMD
CTHDNETPAQKRTVEDTLPNAALVAFCSSAIGSVYGFDECYPHLLNVVDEKRQYSLDDSD
NVNNGIGKVKAKLNNIRQQLAEESEDIARDHEMYIHHEGQYITIQRYNARSGKGWFLIAR
TKFTDHEGEQILSPSTLGGTKVKHEFSYTLKKVGEYEKNDKVLLGIPVQVEEIEAPTVED
ANGDSIIKVNDSFIPGSIAVFSTEIPGVDKKLDDYVRKGAVEASVNLDLYDLNNLLYRCS
PEELDASGGKEDVYDIPGYGRLVYAGLEGWQSALKEVIWSNNLGSSICDHFRQGSWAADY
VVNRLDKYASSSKGLQRFQTWLRERFDAVKNVPYYLRPHYFALIIGIAYEAARFRVLRLL
TPEIQVATNFVQSLALTSVQMVGTMNNTSLLPDKSVPCLAAGLPHFSNDYMRCWGRDVFI
SFRGLLIVPERFDDAKQHILAFAKTLKHGLIPNLLDAGRNPRYNARDAAWFFLQAIQEYV
VNVPLGEEILKEKVSRRFPLDDRYIKYDDPEAFSYESSIEDIIFEILERHAKGIKYREAN
AGPNLDSQMKPEGFDVEVGVDWETGLVHGGQQLNCGTWMDKMGESERAHNKGIPGTPRDG
AAVEIQGLLKSALRWVNELSKKGQFKHKEVTKPNGSKITLKEWEQLVQENFERKFYVPED
ANEDGEYDIDSSLVNRRGIYKDLYKSGKPYEDYQLRANFPIAMCVAPELFDKHHGLVAIR
NADKIIRGPVGIRTLDPLHYNYRPYYNNSVDSDDFATSKGRNYHQGPEWVWCYGYFLRAF
LYFNFAEDDTYSDGHKPSNELFTLLNTRIQHHIEWIKQSPWAGLTELTNKDGELCHDSSP
TQAWSSSCLLDLYYDLWNDSRYQG
NT seq 4575 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacactcgtttaatactatttaggctttcaaatcttggagagcctgtcaataac
gaaaacatcaaaaatggtgtgttgacgttgccagctgacgattacccacaaggcttcaaa
tctggtgatgcattatttgaattgcgtttccagttgaatgctgctagtcaagtttcaaga
aaaggtgtattccatacaaatgtgccaaaaagctttgacatagactttgatagaaataaa
cacaatgcatacccgattgagtcctccttccatcaagatatcacaattaacatcccgata
tacaaaccaggagcttataactactactttacgtatgaagatgaaaacggaaatgaaaag
gaaactgccaaattctactttaacgtgcctccacatttagaactcgacggtaaatttgtg
cccttcaactcgataaacgtcgaaacggttgtttccaagtggattggtccgtatgagaga
tggaacaagttctttggaatagtcaaggctaaagggtacaacatggtccattttacacct
ttgcaacaacgcggtgaatcagactccccatactcaatatacgaccaattgaaatgggat
ccaaaaatcttttcagatcagtcgaaagcaaccaaagagatccacaaggtcttgaacgat
aacaaattgttgagtattacagatgtagtgtggaaccacacggcaaacaactccgaatgg
ttgaaatccgcaccagaatctggctatactcaggatactgcacctcacctcaatgcagct
attgagctcgatgccaaattgttggaatttagtgaaaaattagaagatttgggtttgccg
accgcgattgagagtgaagacgaccttcaaaaaattgttactgcactcaagtcccaagtc
cacgatgagctaaagttgtggcaatactatgtatttgatagaaaaaaagaagttgaaaaa
gttttggacactttcaagagtgggagcgacatctcaaaggcgcagattccaagcagtgtc
aacaccaatgacttgaatcagattgctcaatatactcttgaaaatgccagtgacaataag
caagctatattaggacgcaggtttgagaatgaattgaaccctcgcagttttctttccatt
ttgtatgcaattctaggggactctgttgaggaaaatgcattaaaagctaaagttggtgaa
atagtcgatgagatcaatgcgcccttctatgcccaatacgatgatgatgtcaaaaccatt
gatcaacaagttgccgatagaatcaggttccttcgtttggcagataatggaccgagattg
ggcaagattacagaaaaaaatccgttaacagaaccatacttcacaagatttgtcgacgcc
aacggtaaaaaacaggcactcgcaaacaacggctggatctggggtggcaacccgttggtt
gattttgcatcaaacaagtccaaggcatacttgaggagagaggtgattgtatggggtgat
tgtgtaaaattgcgctatggagcaaagtatgaagactcgccaaaattgtgggataggatt
atagagtacaccaaggaaatggctagggtatttaatgggtttagaattgataactgtcac
agtaccccattaccagttgctgagagattattggatgaagctagaaaagtaaaccctgat
ttgtatgttattgccgagttgttctctggatcagaagagatggacaaaatttttgtcgag
aggcttgcgcttaactcattggtgagagaagctatgcaagcatggagcgttgcagaattg
tcaacattggttcacaaacatggtggaaggcctattggttcacttacttggttgccattg
agtgagttctcctaccctgcaagcaaagagccaaagcttgacagctcccatggtggctat
actgaaatggagatccccaaggttttgactagcacggcaccacacgccatatttatggac
tgtacccacgataatgaaacacctgcacaaaagagaacggttgaagatacgttgccaaat
gcagcattggttgcattttgttcttcggcaattggttcagtatatggttttgatgagtgc
tatccacatcttctcaatgttgttgatgaaaagagacaatatagtcttgatgattccgac
aatgtcaataatggtatcggtaaggtcaaggccaagctaaacaatatcagacaacagttg
gccgaggaaagcgaggatattgcacgtgaccatgagatgtacattcatcatgagggtcaa
tatataacgatccagaggtataacgcccgaagtggtaaaggatggtttttaattgcgaga
acgaaatttacagaccacgaaggcgaacaaattttgtctccctcaacccttggtggtact
aaagttaagcatgagtttagttatacattgaaaaaggttggtgaatatgaaaagaatgac
aaggttttactgggcataccagtacaggttgaagagatagaagcaccaaccgttgaagac
gcgaatggggatagcatcattaaggtcaatgattcatttatccctgggtctattgctgtt
ttttccacagagatcccaggagttgacaagaaattggacgactatgtgagaaaaggggct
gttgaggcatcagtaaacttggatttgtatgacctcaacaatttactctacagatgttcg
ccagaagagttggatgcaagtggaggcaaggaggatgtgtatgatattccagggtatggt
cgtttggtgtatgctggtctcgaaggatggcaaagtgctttgaaggaagttatttggtcc
aataaccttggaagttccatttgcgaccatttccgtcaaggtagttgggcagccgactac
gttgttaataggttagataagtatgcatcgagctcaaaaggtttgcagcggttccaaact
tggttgcgtgagagatttgatgctgttaaaaatgttccttactatttgaggccccactat
tttgcattgattataggcattgcttatgaagcagctcgttttagggtgttgaggttgctc
accccggagattcaagttgctaccaattttgttcagagcttggcattaacaagtgtgcaa
atggtgggaacaatgaacaatacctcgttgttgcccgataagtcagttccctgtcttgca
gcaggcttgcctcatttcagtaacgattacatgagatgttggggaagagatgttttcatt
tcctttagagggcttttgattgttcccgagagatttgatgatgctaagcaacacattctc
gcttttgcaaagactttgaaacacggattgattcctaatcttttggatgctggacgtaac
ccgaggtataatgctagagatgccgcttggtttttcttgcaggctattcaagagtatgtt
gttaatgtccctctgggggaagagattttgaaggaaaaagtttctaggagatttccgttg
gatgatagatatattaaatacgatgatcctgaggcatttagctatgagtcttcgattgaa
gatatcatatttgagatattggagcgtcacgctaaaggtattaaataccgcgaagcaaat
gctggtcctaaccttgattctcaaatgaaacctgaagggtttgatgtcgaagttggagtg
gattgggaaaccggactcgttcatggcgggcaacagctcaattgtggtacttggatggac
aagatgggagagagtgaaagagcgcataataaaggtatccccggtactcctcgtgatggt
gcagctgttgaaatccaaggtttattgaaaagtgctttaagatgggtgaatgaattgagc
aagaaggggcaatttaaacacaaggaggttacaaaacccaacggttcaaagattaccctt
aaagagtgggagcaattggtgcaagaaaactttgaaagaaagttttatgtacctgaagat
gcaaatgaggatggcgaatatgatattgatagttcgttggtgaatagaagaggtatctac
aaggatttgtataaatctggaaagccatacgaagactaccagttgagggccaacttccct
attgccatgtgtgtagcaccagagcttttcgataaacaccatggattggttgcaatacgt
aacgccgataagatcattaggggaccagttggaatcaggactttggatccgctgcactac
aactaccgcccatattataacaattctgttgacagtgacgattttgccacctccaaggga
agaaactatcatcaaggtccagaatgggtttggtgctatggttactttttgagagccttt
ttgtactttaattttgcagaagacgatacatacagcgacggacacaagccttccaacgag
ttgtttacattgttgaatacaagaatccagcatcatatcgagtggattaagcagagtccc
tgggcaggtctcacagaattgactaataaggatggtgagctttgtcatgactcgagtccc
acacaagcttggagtagctcgtgtttgttagatttgtactatgatttgtggaacgacagt
cgctatcaaggttga

DBGET integrated database retrieval system