KEGG   Lodderomyces elongisporus: LELG_04678Help
Entry
LELG_04678        CDS       T01116                                 

Definition
similar to ubiquitin-specific protease
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LELG_04678
Peptidases [BR:lel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LELG_04678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 942 aa AA seqDB search
MSAHRSSSTSTANTQASSSNSSSLRFRGDAVSFAPSFQPYQAQAQFASPLIPQGLPHYAN
THGAPLQYPYQHPQQQTPRQHMAAAAAAVPPQSHYYVPYGTPSYPMMTPHMYHLYMQDMY
LPHPSLQPYMIPPAFAPQSHMPQPMPPPMPHQQFSPVQHPQKPAKQNHNNNHNQNHNHNH
NHNQNYNQNQNLHHHLQTRLHLHNQQHLNHQFANDNKNTPQRTSTDLPSVVNDNDKNGNS
LPVPSPSPSRSSSPAQQQIQPQGSSKGSRKNSVPSTQVPESSKENVLNGSIEEKTSEEDE
KGEKEKKEEKKKKDVNDIITTTAAAATKTSNSETLRVLPLYVNISRTEFSSIFPMTEQTR
FIDNITRLNRLADGVNDTQKFILSTGFVNYVDANGTSKLITPNNGVGAGSQPNKKLSEQT
KQNSQDATVNNNWASILQSTAQAVTQKKTIKKPLGSAVPASSSSSSTTTTTTPFSSSSSS
SYSPSSSSSSSSSSTITPNSKQTVQTTSVLHSRVTSDVSNFSFVESELAQPLGVLLLKIM
FDKKYSIFNNFPTFDVKPKGLTNTGNICFMNSILQILLYCQPFNRLLKLIETKSISELVN
SSLPLLDATIKLFNDFKPVHSDSSNGSINNGKAAVPIEPFYHALSKHSKFSHLRWGQQED
AEEFLGYYLDALNEEFLTALRRLNTSQVDTLIQSYSQEDSHELTKFKYNVKTCIRRIKKE
NDGEDEDEWNQVGAKKNVTKVEVEPTPLNMIFGGEFKSIITIPKGSSFQKSITIDPFQQL
QLDISQSDSIDDAFLHLNEVESISYMSNNNSELQVKKQTFVSKLPEVLIIHLKRFSYLKD
QEVAIEKLKKLVAYNHKLSVPSQILSAEAQASVSTYQLSSVVYHHGANADTGHYTSDIYD
YELKQWWRIDDTIVNSIKANEVLNSGNDENSKNAYILVYEKI
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcccaccgttcatcatctacttcgaccgcaaatacacaagcaagctcttcaaac
agcagctcgctgcgtttccgtggtgatgcagttagttttgcaccaagttttcaaccttac
caagcacaagcacagtttgcatctccgctcataccacagggactgcctcattatgcaaat
acacatggtgcacctcttcaatacccttaccaacatccccaacaacaaacccctagacaa
cacatggcagcagcagcagcagcagtccctcctcaatcccactattatgtcccttatggt
actccgagctatcccatgatgactcctcatatgtaccacctttacatgcaagacatgtat
ctgccgcatccttcactgcagccttatatgattccaccagcgtttgccccgcaatcgcat
atgcctcaacccatgccgccaccgatgccacatcaacagttttctccggtacaacatccc
cagaaacctgcaaaacagaatcataataataatcataaccaaaatcataatcataatcat
aatcataatcaaaattataaccaaaatcaaaatctgcatcaccatctgcaaaccagatta
catctgcataatcaacagcatctgaatcaccagtttgcaaatgataataagaacaccccg
cagcgcactagtactgacttgccaagtgttgtcaacgacaatgacaaaaatggcaattcg
ttacctgtgccctccccatctccatcccgatcttcgtctccggctcagcaacaaatacaa
ccacagggttcgagtaagggaagtcggaaaaattcggtgccaagtacacaggttcctgaa
tcgtccaaagagaatgtattaaatggtagtatagaggagaagacctctgaagaagatgaa
aaaggggaaaaagaaaaaaaagaggaaaaaaagaagaaggatgtaaatgacattattact
accactgctgctgctgcgaccaaaacttccaactctgagactctgcgtgttttgccacta
tatgttaatattagccgtactgagttttcaagtatattccccatgacagaacaaacccgt
tttattgacaatatcactagattgaacaggttggctgatggtgtaaatgatacgcaaaag
ttcatattgagcactggttttgtcaattacgttgatgcaaatggtacaagcaaacttatc
acacccaacaatggtgttggagctggctcgcaacccaataaaaaactgtcagaacagaca
aagcaaaactcacaagatgcaactgtgaacaacaattgggcatcgatcttacaatcgact
gcgcaggcagttacacagaagaagaccattaagaaaccattgggatcggctgtgcctgca
tcatcatcatcatcatcaacaacaacaacaacaacacctttttcttcatcttcttcttcg
tcttattccccttcgtcgtcatcctcttcttcttcttcatcaacaatcaccccaaattct
aaacagacagtacaaaccacatccgtcctgcattcaagggttactagtgacgtgagcaat
ttttcatttgttgaaagtgagctggcacaacctttgggtgtcttactactcaaaattatg
tttgataaaaaatattccatcttcaataatttccccacttttgacgttaaaccaaaaggt
ttgaccaacacgggtaacatttgctttatgaactccatattgcagatattactctactgc
cagccgttcaatagactcttgaaattaattgagacaaaatccatcagtgagttggtgaat
tcctcgctgcctttgcttgatgcaacaattaagctttttaatgatttcaaaccagtgcac
agtgacagcagtaatggcagtatcaacaatggcaaagcagcagttccgatcgagcctttt
taccacgctttgtcaaaacatagcaaattctctcatttgagatggggacaacaagaagat
gccgaagagtttttaggttactaccttgatgcgctcaatgaagagtttttgacagctttg
cgcaggctaaacacttcacaagtagatacacttatccaatcttattctcaagaggatagt
catgagcttacaaaattcaaatataatgtgaaaacttgtatacgcagaattaaaaaggaa
aacgatggtgaagatgaagatgagtggaatcaagttggggccaagaagaatgtaaccaaa
gttgaagttgaaccaacacccttgaatatgatctttggtggtgaattcaaatcgatcatt
accataccaaaaggctcgtcttttcaaaaatcaattacaattgaccccttccagcaatta
cagctcgatatttcccaatcagatagtattgacgatgcgtttttgcatcttaacgaggta
gaatctatttcatacatgagcaataacaattcggagttgcaagtgaagaaacaaacgttt
gtttcaaagttacccgaggtcctaatcatacatttgaagaggtttagttatctgaaggac
caagaggttgcgattgagaagttgaaaaaattagtcgcatacaatcacaaattatctgta
ccttcccagattctttccgctgaggcacaagcttcagtgagtacgtaccagttgtcatcg
gtggtatatcatcatggtgctaatgcagataccggtcactatactagtgacatttacgac
tatgagctgaaacaatggtggagaattgacgacactatagtcaattcgattaaagctaac
gaagttttgaattccggtaatgatgaaaacagtaaaaatgcttacattttggtttatgaa
aagatttaa

DBGET integrated database retrieval system