KEGG   Lodderomyces elongisporus: LELG_04681Help
Entry
LELG_04681        CDS       T01116                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lel  Lodderomyces elongisporus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LELG_04681
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LELG_04681
Enzymes [BR:lel01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LELG_04681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 160 aa AA seqDB search
MSKFYQLKAKLPNGEEYSFEQLKGKVVLIINVASKCGFTPQYAGLEELNQKFAKENVQLL
GFPCNQFGNQEPGTAEEIALFCSTKYNVTFPVMAKVNVNGDNTCEVYQYLKLQKKALGLS
RIKWNFEKFLIDQEGNVVERFSSLTKPADIAPKIEQLLKK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagttttatcaattaaaggcaaagctccctaatggtgaggaatactcatttgag
cagttgaaaggcaaagtcgtgctcattatcaatgttgctagtaaatgtggattcactcca
caatatgctggtctcgaggaattgaaccaaaagtttgccaaggagaatgtgcaactcttg
gggttcccttgtaatcagtttggaaaccaggagccaggcactgctgaagagattgcgctg
ttttgctccaccaaatataatgttactttcccagttatggccaaagtgaatgtcaatggt
gacaatacgtgtgaggtttaccaatacttgaagctgcagaaaaaggctttgggattgagt
agaataaagtggaattttgagaaatttttgattgaccaagaaggaaatgttgtagagagg
ttcagctcattaaccaaaccagctgacattgctcccaagattgaacaattgttgaagaaa
tag

DBGET integrated database retrieval system