KEGG   Lodderomyces elongisporus: LELG_04684Help
Entry
LELG_04684        CDS       T01116                                 

Definition
(RefSeq) halotolerance protein HAL2
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00920  Sulfur metabolism
lel01100  Metabolic pathways
lel01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    LELG_04684
Enzymes [BR:lel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     LELG_04684
Transfer RNA biogenesis [BR:lel03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    LELG_04684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P TPK_catalytic
Motif
Other DBs
NCBI-GeneID: 5231197
NCBI-ProteinID: XP_001523871
UniProt: A5E4Z5
AA seq 374 aa AA seqDB search
MKAFILLFTIVFAVLLRRLSIMAHPYAKELEVATLAVKRASILTKQLSDSISKEGTITKE
DKSPVTVGDFASQAIINHALKINFPTDEIVGEEDSQHLQENDELANKVLSLIEKVQLETS
DFQKVLGELKDKQSVFQSIDLGNSQGGSKGRFWALDPIDGTKGFLRGDQFAVCLALIEDG
KVVLGVIGCPNLAKKVESNTKHSGIVGGLYSAIKGLGAYYSPLFDEISFQPLSKQERIQM
TQHSTPDELKVVEGVEKGHSSHSTQAKIKETLGFNPDTVQEQTINLDSQVKYCALASGQA
DIYLRLPINDTYREKIWDHAAGNVLVYEAGGRVGDITGQPLDFGKGRLLPSKGVIAGNDK
IFDKVIEAVNSVVE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcattcatcttactatttaccatcgtgtttgccgtactactccgaagattgagc
atcatggcacatccttatgcaaaagagttggaagttgccactttagctgtcaaaagagct
tccatattgacaaagcaattgagtgattctatttcaaaggaaggcacaattacaaaagag
gacaagtctccagtcacagtgggtgattttgcaagtcaggcaattatcaatcatgctttg
aagatcaatttcccaacagacgagattgttggagaagaggattcacaacatttgcaagag
aatgatgaattggcaaacaaagtattgagtttgattgaaaaagtacaactggaaacaagc
gactttcaaaaagttcttggagagttgaaagataaacaatctgtgtttcaaagcattgat
ttgggtaactcccaaggtggatcaaagggaagattttgggcattggacccaatcgatgga
acaaaaggcttcttaagaggtgaccagtttgccgtgtgtttggcattgattgaagatggg
aaagtagtcttgggtgttattgggtgtccaaaccttgcaaaaaaagttgagtccaataca
aaacatagtggtattgtaggtggattatactccgcaatcaaaggtcttggtgcgtactat
tcgccactctttgacgagatttcattccagcctttgagtaaacaagaacgcattcaaatg
acccagcacagtacaccggatgaattaaaagttgttgaaggtgttgaaaagggtcactca
tcacattcgacgcaggcaaagattaaagaaacacttggattcaatccagatacagtacaa
gagcaaactataaatttggactcgcaagtgaaatattgcgcgcttgccagtggacaagct
gatatatacttgagactcccaataaatgatacatatagagagaaaatctgggaccacgct
gctggaaacgttttagtttatgaggctggtggcagagtgggtgacatcactggccaacca
ttggactttggaaaaggtagacttcttccttcaaagggtgtcattgctggtaatgacaag
atttttgataaagttatagaggcagttaacagtgttgttgaataa

DBGET integrated database retrieval system