KEGG   Lodderomyces elongisporus: LELG_04684Help
Entry
LELG_04684        CDS       T01116                                 

Definition
halotolerance protein HAL2
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
lel  Lodderomyces elongisporus
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:lel00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 374 aa AA seqDB search
MKAFILLFTIVFAVLLRRLSIMAHPYAKELEVATLAVKRASILTKQLSDSISKEGTITKE
DKSPVTVGDFASQAIINHALKINFPTDEIVGEEDSQHLQENDELANKVLSLIEKVQLETS
DFQKVLGELKDKQSVFQSIDLGNSQGGSKGRFWALDPIDGTKGFLRGDQFAVCLALIEDG
KVVLGVIGCPNLAKKVESNTKHSGIVGGLYSAIKGLGAYYSPLFDEISFQPLSKQERIQM
TQHSTPDELKVVEGVEKGHSSHSTQAKIKETLGFNPDTVQEQTINLDSQVKYCALASGQA
DIYLRLPINDTYREKIWDHAAGNVLVYEAGGRVGDITGQPLDFGKGRLLPSKGVIAGNDK
IFDKVIEAVNSVVE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcattcatcttactatttaccatcgtgtttgccgtactactccgaagattgagc
atcatggcacatccttatgcaaaagagttggaagttgccactttagctgtcaaaagagct
tccatattgacaaagcaattgagtgattctatttcaaaggaaggcacaattacaaaagag
gacaagtctccagtcacagtgggtgattttgcaagtcaggcaattatcaatcatgctttg
aagatcaatttcccaacagacgagattgttggagaagaggattcacaacatttgcaagag
aatgatgaattggcaaacaaagtattgagtttgattgaaaaagtacaactggaaacaagc
gactttcaaaaagttcttggagagttgaaagataaacaatctgtgtttcaaagcattgat
ttgggtaactcccaaggtggatcaaagggaagattttgggcattggacccaatcgatgga
acaaaaggcttcttaagaggtgaccagtttgccgtgtgtttggcattgattgaagatggg
aaagtagtcttgggtgttattgggtgtccaaaccttgcaaaaaaagttgagtccaataca
aaacatagtggtattgtaggtggattatactccgcaatcaaaggtcttggtgcgtactat
tcgccactctttgacgagatttcattccagcctttgagtaaacaagaacgcattcaaatg
acccagcacagtacaccggatgaattaaaagttgttgaaggtgttgaaaagggtcactca
tcacattcgacgcaggcaaagattaaagaaacacttggattcaatccagatacagtacaa
gagcaaactataaatttggactcgcaagtgaaatattgcgcgcttgccagtggacaagct
gatatatacttgagactcccaataaatgatacatatagagagaaaatctgggaccacgct
gctggaaacgttttagtttatgaggctggtggcagagtgggtgacatcactggccaacca
ttggactttggaaaaggtagacttcttccttcaaagggtgtcattgctggtaatgacaag
atttttgataaagttatagaggcagttaacagtgttgttgaataa

DBGET integrated database retrieval system