KEGG   Lodderomyces elongisporus: LELG_04768Help
Entry
LELG_04768        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lel  Lodderomyces elongisporus
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:lel00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    LELG_04768
Enzymes [BR:lel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     LELG_04768
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     LELG_04768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 508 aa AA seqDB search
MLKRNVLGCKISSVDLPIDRLLWPAMKIADDPEITASSIKSKLLNSIIVSVGRHGKYFWM
RLKQPKMEHTQVLLMHLGMTGRIKLCNVESELVFMENGGDKKLLEEELAKEKDKNVVTSS
RVKMAMEVGQKQGVQRGNTEVKIELEGETSSWPPKFTKLEMTLRQDSDHGNEEFWAFVDP
RRLGRIRLLEGEEIQTDEGLLKTPPLDLQGPDYSKPPTRCLSDPSSAVFVSGDPDPDHHG
RPRPSLEEFSQVVLKSKKTIKSMLLDQARFAGVGNWVADEVLFHAKLHPEEVLPLKIKLD
SPVLYTLYKSLIHVCETSVALEGSARRFPENWLMRHRWGKGRKRDGPHQTAEGILLDHIT
VGGRTSCYAPSVQKLLKPEPGVNKVQEKPQKGTKTNGDGVSITRTNKVKRRLEQQDERKV
KDKDKDKDKGGVEVKDKDEIEDKDEIKEEVEVEEEEAEQQQQQRDLETNVIKTNKRIKIE
KVEPKTNVVRNGIRKSARLRSRLKPTID
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaagaaatgtccttgggtgcaaaatcagcagtgttgatttgccaatcgatcgt
ctactctggccagcaatgaaaatagcagatgaccccgagattacagcaagttcaattaag
agcaagttgttgaacagtattatcgtatcagttggtagacatggcaagtatttttggatg
cggttgaagcagccaaagatggaacacacccaagtgttattaatgcaccttggaatgact
ggtcggatcaaactatgcaatgtcgaatctgaacttgtctttatggaaaatggtggcgat
aaaaaattactcgaagaagagctagccaaagagaaagacaagaatgtggtcactagttcg
agagttaaaatggccatggaagtgggacagaaacaaggagtacagagagggaatacggaa
gttaagatcgagctggaaggagaaacatcttcttggccgcccaagtttacaaagcttgag
atgactttgcggcaagactctgaccatggaaatgaagaattttgggcttttgttgatcca
agacgtcttggtagaattagacttctcgaaggagaagaaattcaaacagacgaaggattg
ttgaaaacaccacctttagatttgcaaggacccgactacagcaaaccacccactagatgt
ctttcagacccatccagtgctgtttttgtaagcggtgatcccgaccctgatcaccatggt
aggccgcgtcctagtttagaagaattttctcaagtggtgctcaagtctaaaaagacgatc
aagtcaatgctacttgatcaagcacggtttgccggtgttggaaattgggtagctgacgaa
gttttatttcatgctaaattacaccccgaagaagtgttgcctttaaagattaagttagac
tccccagtcttgtacacattgtacaagtctttgatacatgtatgcgagacatcagttgcc
ttagaaggaagtgcgagaagatttccagaaaattggttaatgcgtcatagatggggtaaa
ggaagaaaaagagatggaccgcaccaaacagctgaaggtatcttgttggatcatataacg
gttgggggtcgtactagttgctacgccccaagtgtacagaaacttttaaagccagaacca
ggtgttaataaagttcaggagaaaccacaaaagggaactaaaacaaatggggatggtgtt
agtattacaaggacgaacaaagtaaaacgtaggcttgagcagcaagatgaacgtaaggtc
aaggacaaagacaaagacaaagacaagggaggagttgaagttaaagataaagacgaaatt
gaagataaagatgagataaaagaagaagtagaagtagaagaagaagaagcagaacaacaa
caacagcaacgagatctagagacaaatgttataaaaaccaataagaggataaagatagaa
aaagtagaaccaaagacaaatgttgttcgcaatggcatcagaaaatccgccaggttaaga
tcgagattaaagccaacaatagactaa

DBGET integrated database retrieval system