KEGG   Lodderomyces elongisporus: LELG_04769Help
Entry
LELG_04769        CDS       T01116                                 

Definition
similar to arginase family protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
lel  Lodderomyces elongisporus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LELG_04769
Enzymes [BR:lel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     LELG_04769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 366 aa AA seqDB search
MKLLLTLLGILQVCIATDLEEKWGSLWQFQGIATFAHLEHTQCLVNPKESFDVAVIGVPF
DTAVSYRPGARFGPRAIRDASQRQYSLRGFNHRALFNPYKSWAKIIDCGDIPVTPMDNHL
AFKQMDIAFDELLQRSSANDSRVPPRYVVLGGDHSVLLPHLRALKKHYGRLNVLHFDAHL
DTWSPLKYPSFWRTDQNDLNHGSMLWQAHEEGLTTNRNVHAGVRTKLSGIEDYQDDDAQN
WVRIEADDIWLKGPQYVVDKILETIPKDSPTYLSVDIDVLDPGFASGTGTQESGGWLPRE
LIHILRGVEELTIVGADVVEVAPAYDVSEVTATNGAQMAFEILTSMVKKGNVDKNIVDRT
IEIFES
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcttattgacattgcttggtatactccaagtatgtattgctacagacttggag
gaaaagtggggtagtttatggcaatttcaaggcattgcaacatttgcccatttagagcat
actcaatgcttagtcaaccccaaggaatcatttgatgttgccgttataggtgttccattt
gatactgcagtttcgtaccgtccgggtgcaaggtttggtccaagagccattcgtgatgca
tcgcaacgtcaatatagtttgcgtggctttaatcatagggctttgttcaacccgtataaa
tcatgggccaaaatcatcgactgtggagatatacccgtgacaccaatggataatcatctt
gcatttaagcaaatggatattgcctttgatgagttgttgcaaagatcatcagctaatgat
tcccgggtccctcctagatatgttgtgcttggcggtgatcattctgtattgttaccacat
ttgagagctttgaagaagcattatggacgtttaaatgttttgcattttgacgcacatcta
gatacgtggtcaccactgaaatacccctcgttttggagaacggaccagaacgacttgaat
catggttcaatgttgtggcaagcgcacgaagaagggctaaccacaaatcggaatgttcat
gctggtgtacgcactaaactttcagggatagaagattatcaagatgatgatgcacagaac
tgggttaggattgaagccgatgatatttggttgaaaggtcctcagtacgttgttgataag
atcttggaaaccataccaaaagattcaccaacttacctctctgttgatattgatgttctt
gatccagggtttgcatctggtacgggaactcaagaatctggaggatggttacccagggag
ttaattcatatactacgcggagtcgaagagttaactatagttggcgcagacgtggttgag
gttgcaccagcttatgatgtatcggaggtcacagctacaaatggagcacaaatggcgttt
gagatattgacgagcatggtgaaaaagggcaacgttgacaaaaacatagttgaccgcacc
atcgagatttttgaaagttga

DBGET integrated database retrieval system