KEGG   Lodderomyces elongisporus: LELG_04774Help
Entry
LELG_04774        CDS       T01116                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
lel  Lodderomyces elongisporus
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:lel00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    LELG_04774
Exosome [BR:lel04147]
 Exosomal proteins
  Proteins found in most exosomes
   LELG_04774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1676 aa AA seqDB search
MSDIPIDFTELAQLTLLGISASSLDFKSTTLESDRYVCCREQGPQGNTVAIVDLQNNNEV
TRKNMTADNAIMHPTENVISLRANGTTLQIFNLGTKQRLKAHTMNEPVIYWKWLDNKHLG
LVTQSLIYFWNVFDGTNDGPSKLTDRHHSLNNAQIINFVAEPDLNWFAVTGIAQEDGRIA
GHIQLYSKSRNVSQAIEGHVCKFASITLSGASHPTKVFCVGNKNAQGQGNMHIIEIDHVD
GNPPFQKKQVDIFFPPDASNDFPISLQASNKYGIIYILTKYGFIHLYDMETGANLFVNRI
TADPVFTATSYNNGTGILTVNKSGQVLSVEVSREKIIPYVLEKLSNVPLALALSSRGGFP
GAENLFTQQFQNYLNQGDYTNAAKVAASSEQLRTQDTINKLKHITPQPGQISPILQYFST
LLDRGTLNKYESIELAKPVLQQDRKPLFEKWLKEDKLTSSEELGDIVKSYNDTTLALAVY
IRANVNIKVVSCLAELGQFDKIVPYCEKVGYNPDFTNLIQNLVRVNPDKASEFATSLLAS
PATDSKLNVEQIADLFFSQNYIQQGTAFLLDALKNDSPSEGHLQTKVLEINLLHAPQVAD
AILGNQMFSHYDKPTIGKLCEKSGLFQRALEHYDDLKDIKRVIVHTNVLPSDWLVSYFGQ
LNVDQSIACLKELFSHNLQQNLQVIIQVATKYSDLIGPQKLIKLFEEYKCSEGLYYYLSS
IVNLTQDSDVVFKYIQAAARIGQTKEIERVVRDNNVYNGEKVKNFLKEFKLEDQLPLVIV
CDRFNFVHDLILYLYKNQYFKFIEVYVQSVNPSNTPQVIAGLLDVDCDEAVIKNLLMSVL
GRVPIKTLVEEVEKRNRLKILLPYLEKTLEGGSNDQEVYNALAKIYIDSNNSPEKFLQEN
NNYDTLVVGKYCEKRDPYLAYISYSKGGNDDELINITNENKMYKYQARYLLQKSDLDLWN
KVLGSDNIHRRQLVDQVISTGIPELDDPEPISITVKAFMENDLPEELMELLEKIILEPSA
FSENASLQGLMILTAIKADSSKVSGYIEKLDKFDPQEIAPLCIDNGLNEEAFEVYDKFEL
RSEAMNVLVESIVSLDRAEQYAEKYDTPELWYQLGTAQLDGLRIPEAIDSYIKSKNPENF
EQVIDIAEHAGKEEELLPYLEMARETLREPVIDGAIINAYATLDRLRDMESFVGGSNVAD
LETIGDKLFEAKNYKGAKILYSNVSKYSKLATTLVYLEDYQGAVDCARKASNISVWKQVN
NACIENKEFRLAQICGLNLIVDAEELPELVKTYEYNGYFNELISLFESGLGLERAHMGMF
TELAILYAKYTPEKVMEHLKLFWSRINIPKVLTACEDAHLYPELIFLYCHYEEWDNAALT
MIEKSEVAFDHSSFKEIIVKAPNLEIYYKAIQFYLNENPSLLVDLLSVLTPKLDLPRVVR
MFIKSDNLPMIKPFLISVLDKNNSVVNSAYHDLLIEEEDYKSLRSSIEHESNNRFNKLDL
AERLEKHDLIFFRQIAATLYAKEKKYNKAISILKADKLWSDLLKVVAISKSPKIARDILD
YFVETGNHECFVALLYTSYEYISHDYVMEVSWLHNLSNFIKPYEISIAYENQKKLNELYV
DLKKRQDAEKGDEESSKNGQAPLMLTNGPMSFQNTGLLSAPSLGFQPTGTGFGNAF
NT seq 5031 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatattccaattgatttcacggagttggcgcaactcacgctgttgggcatatcc
gcttcatcattggactttaaatcaaccacattagagtctgaccgctacgtatgttgtcgt
gagcaaggtcctcaaggtaacactgttgctattgttgatttgcagaacaacaatgaggtt
acaaggaaaaacatgactgccgataatgccatcatgcacccaactgagaatgtcattagt
ttgcgagctaatggtaccacgttgcagattttcaatttaggcactaagcaaagattgaaa
gcccacactatgaacgaaccagtgatatattggaaatggctagataacaaacatttgggg
ttggtcactcaatcactgatttatttctggaacgtgtttgatggtaccaatgatggacca
tcgaaattgacagatagacaccattcattgaacaatgcacaaatcatcaactttgttgct
gaaccagacttgaactggtttgcagtcactggtattgcccaagaagatggaagaattgct
ggtcacattcaattgtactcgaaatcaagaaatgtgtcccaagcaattgaaggccacgtt
tgtaaatttgcttcaattactttgagtggcgcttcacacccaactaaagtgttttgtgtt
ggtaataagaatgctcagggccaaggtaacatgcatattattgaaattgatcatgttgat
ggtaacccaccctttcaaaagaagcaagttgacatctttttcccaccggatgcttcaaat
gatttcccaatcagtttgcaagcttccaacaagtatggaatcatttatattttgaccaag
tatggtttcattcatttgtatgacatggaaactggtgcgaacttgtttgtcaatagaatc
actgccgacccagtgtttacagcgacaagctacaataacggaactggtatcctcaccgtg
aacaagtctggccaagtcttgagcgttgaagttagcagagaaaagatcataccatatgta
ttggaaaaattgtccaatgttcccttggcattggccttgtcttcgcgtggaggtttccca
ggtgcagaaaacttgtttactcaacaatttcaaaattaccttaaccaaggtgactacacc
aatgctgccaaagttgcagcatcttctgagcaattgcgaactcaagacaccatcaataaa
ttgaagcatatcactccacaacctggtcaaatctccccaatattgcaatatttttcaacc
ttgttggatcgtggaactttgaataagtatgagtctattgagttggccaaaccggtattg
caacaagaccgtaaaccattgtttgaaaaatggttaaaagaggacaagttgacttcgtca
gaagagttgggtgatatcgtcaaatcatacaatgacacaactttggcgttggctgtgtac
attagagccaatgtcaacattaaagttgtctcttgtttggccgagttgggtcaatttgat
aagattgttccatactgtgaaaaagttggttacaatccagatttcaccaacttgatccaa
aacttggtgagagttaaccctgataaggctagcgagtttgccacttcattattggccagt
cctgcaacagattccaaattgaatgtcgaacagattgccgatttgttcttttctcagaat
tatattcagcaaggaactgcattcttgttggatgcattgaaaaatgactcaccttctgag
ggtcatttgcaaactaaagtgttggaaatcaacttgttgcatgctccacaagtggctgat
gcaattttgggtaaccaaatgttcagtcactatgacaaaccaactattggtaagttatgt
gagaaatctggtttgttccaaagagctttggagcattacgatgacctcaaggatatcaag
agagttattgttcataccaatgtcttacctagtgactggctagtttcttattttggtcag
ttgaatgtcgatcaatcaatcgcatgtctcaaggagttgtttagccacaacttgcaacaa
aacttgcaagtaattatccaagttgccaccaaatattctgacttgattggtcctcaaaag
ttgattaaattatttgaggaatacaaatgtagcgaagggttgtattattatttgagctca
atcgtgaatcttacccaagactcagatgttgtgttcaaatatatccaagctgctgctaga
attggccagacaaaggaaattgaaagagttgttagagacaataatgtttacaatggtgag
aaagtgaaaaactttttgaaagaattcaaattggaagatcaattgccattggtgattgtg
tgtgacagattcaactttgtgcatgatttgatcttgtacttgtacaagaaccaatacttt
aagtttattgaagtatatgtccaatcagtcaatccttcaaacactccgcaagttattgct
ggtttgttagatgtagactgtgatgaagcagttattaaaaacttgttgatgtcagtgctt
ggaagagtccctatcaagacattggttgaggaagttgaaaagagaaacagattaaagatt
ttgttgccatatttggaaaaaacattggagggtggctccaatgaccaagaagtttacaat
gcgttggccaagatctatatcgactccaacaactcaccagagaaattcttgcaagaaaac
aacaactacgatactttagttgttggtaagtattgtgaaaagagagacccatacttggcg
tacatttcatattcaaaaggtggcaatgatgatgagttgatcaacattactaatgaaaac
aagatgtacaaataccaagctcgttatttgttgcaaaaatcagatcttgatttgtggaac
aaagtacttggctctgataacatccacagaagacaattggtggaccaagttatctcaacc
ggtatcccagagttggacgacccagaaccaatctccattacagtcaaggcgtttatggag
aatgatttgcccgaagagttgatggagttgcttgaaaaaattattttggaaccatctgca
tttagtgaaaatgcttcattgcaaggcttgatgatcttgactgcaattaaagctgactct
tcaaaggtttccggatacattgagaagttggacaagtttgatcctcaagagattgcacct
ttgtgtatagataatggcttaaacgaagaagcatttgaggtgtatgacaagtttgaattg
agatcagaagctatgaatgttttggttgagagcattgtttctttagacagagctgagcaa
tatgctgagaaatatgatacacccgaattgtggtatcaattgggtactgctcaattagat
ggtttaagaatccctgaagcaatcgactcatacatcaagtctaagaatcccgagaatttc
gaacaagtcattgatattgccgagcatgcaggcaaggaggaagaattacttccatacttg
gagatggctagagagacattgagagaacctgttattgatggtgctatcatcaatgcatat
gctactttggatagattaagagacatggaaagttttgttggtggatcaaacgttgctgat
ttggaaaccattggtgacaagttgtttgaagccaaaaactacaagggagccaagattttg
tattcgaatgtttctaaatattctaaattggcaactactcttgtttacttggaagattac
caaggtgcagtcgattgtgctagaaaagcatcaaacattagtgtttggaaacaggtcaat
aatgcctgtatcgagaacaaagaatttagattggctcaaatttgtggtttgaacttgatt
gtcgatgctgaggaattacccgagcttgtaaagacttatgaatacaacggttatttcaat
gagttaatttcattgtttgaaagtggtttaggtttggagagagcacatatgggtatgttt
accgaattggcgatcttgtacgccaagtatacacccgagaaagtgatggagcacttgaag
ttgttctggtcaagaatcaatatccccaaggtattgactgcgtgcgaagatgcgcacttg
tacccagagttgatatttttgtactgtcattatgaagagtgggacaatgctgcattaact
atgattgaaaaatcagaagttgcatttgaccattcttcattcaaggaaatcatcgttaaa
gctccaaacttggaaatttactataaggccatccaattctacttgaatgagaatccatcc
ttgttggttgacttgttgtctgtgttgacgccaaaattggatttgccaagagttgtgaga
atgtttatcaagagtgacaacttaccaatgattaagcctttccttatctctgttttggac
aaaaacaatagtgtcgttaactcagcataccatgatttgcttattgaagaagaagattac
aagtcactccgctcttctattgagcatgagtcaaacaatagatttaacaaattagatctt
gctgaaaggttagagaaacatgatttgatcttttttagacaaattgccgccactctttat
gccaaagagaaaaaatacaacaaggccatctctattctcaaagctgataagttgtggtcg
gacttgttgaaagttgttgccatttcgaaatcgccaaagattgctcgtgatatactcgac
tattttgttgaaactggtaaccacgaatgttttgttgctcttttgtacacctcatacgaa
tacatctctcacgactatgtgatggaagtatcatggttacacaacttgagcaatttcatt
aagccatacgagatttccatcgcttatgagaaccaaaagaagttgaatgagttgtatgtt
gatttgaaaaagagacaagatgctgaaaaaggtgacgaggagtcgagcaaaaatggacaa
gctccattgatgcttaccaacgggccaatgagtttccaaaatacaggacttctgtctgca
ccatccttgggtttccaaccaactggaacaggatttggtaacgcattttag

DBGET integrated database retrieval system