KEGG   Lodderomyces elongisporus: LELG_04814Help
Entry
LELG_04814        CDS       T01116                                 

Definition
similar to NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
lel  Lodderomyces elongisporus
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LELG_04814
Enzymes [BR:lel01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     LELG_04814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 300 aa AA seqDB search
MSVSRLFSNPKFVYPLVGATIGSIGLAYYSTQAQFYIANETGKTFTGGDQWIDLKLKKSE
DLTHNTKHLTFELLNPDDVSGLITASMLMTKYVTPKGNNVIRPYTPVSDPDQKGTLDFVI
KRYENGKMSNHIHNLKEGETLSFKGPVVKWKWEPNQFKSIALIGGGTGITPLYQLLREIT
SNPEDKTKVSLIYGNTSPEDVLIKDRIDDIAAKHKDQVKVTYFVDENKATKDWEGEVGFI
TKEFLEKELDKPSPDFKIFVCGPPGLYKAISGVKVSPTDQGEVEGALKDLGFSKEHVFKF
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtttcaagattattttccaaccctaaattcgtttacccattggttggtgccact
attggctcaattggtttggcatattactcaactcaagcacaattttacattgccaacgag
accggaaagacattcactggtggtgaccaatggattgacttgaaattgaagaaatccgaa
gatctcacacacaacaccaagcacttgacctttgagttgctcaacccagatgatgtttct
ggattaattaccgcttcaatgttgatgactaaatacgtaacaccaaagggtaacaatgtt
attagaccatatactcccgtctctgacccagaccaaaagggcactcttgactttgtcatc
aagagatatgaaaatggtaaaatgtcaaaccacattcacaacttgaaagaaggagagact
ttatcattcaagggacctgttgtgaaatggaagtgggaaccaaaccaattcaagtcaatt
gccttgattggtggtggtactggtatcacaccattataccaattgttgagagaaatcact
tcaaacccagaagacaagaccaaggtcagcttgatctacggtaacacctcaccagaagat
gtattgatcaaggacagaattgatgacattgctgctaagcacaaggaccaagtgaaagtc
acctactttgttgatgaaaacaaggcaaccaaggattgggaaggtgaagttggtttcatc
accaaggaattcttggagaaggagttggacaagccaagcccagacttcaagatctttgtt
tgtggtccaccaggtttgtacaaggccatctctggtgtcaaagtctcaccaaccgaccaa
ggtgaagttgaaggtgctttgaaagatttgggattcagcaaagaacacgtttttaaattt
tag

DBGET integrated database retrieval system